KEGG   Beijerinckia indica: Bind_0254Help
Entry
Bind_0254         CDS       T00688                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bid  Beijerinckia indica
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bid03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(291789..292394)
Genome map
AA seq 201 aa AA seqDB search
MTAPIAGPEIERLIHLLARLPGLGPRSARRAALHLIRKRTELLGPLAEALQQAYNHLIPC
QICGNIDTRDPCTICADAKRDPTLLVVVETVADLWALERAAALPARYHVLGGTLSPLDGV
GPKDLNLQSLTERVAQGEIREVILAVNATVDGQTTAHYITDSLAAFPVKITRLAHGVPVG
GELDYLDEGTLAAALRSRTNF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgcctattgccggaccggaaatcgagcggctcattcatttgctggcccgcctg
ccgggccttggtccgcgctcggcccggcgagcggccttgcatctgatccgcaagcgcacg
gagcttcttggccccctcgccgaggccttgcaacaagcatataatcatctgatcccctgc
cagatttgcggcaatattgacacgcgtgatccctgcaccatctgcgccgacgccaaacgc
gaccccactttgctggtggtcgtcgaaaccgtggccgatctctgggcactcgaacgcgcc
gccgccttgcctgcccgatatcacgtcctcggcggcacgctttcgcctctcgatggggtc
ggccccaaggatctcaatcttcagagcctgaccgagcgggtcgcccaaggcgagatccgc
gaggtcattctggcggtcaatgccacggtcgacggccagacgacggctcattacatcacc
gacagtctggcggccttccccgtcaaaatcacccgcctcgcccatggcgttccggtcgga
ggcgaacttgattatctcgatgaaggaaccctcgccgcagccttgcgcagccggacaaat
ttttga

DBGET integrated database retrieval system