KEGG   Beijerinckia indica: Bind_0380Help
Entry
Bind_0380         CDS       T00688                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bid  Beijerinckia indica
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Bind_0380
Enzymes [BR:bid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Bind_0380
Exosome [BR:bid04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bind_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
438366..439889
Genome map
AA seq 507 aa AA seqDB search
MTKYVAVIDQGTTSTRCMVFNKQGEIVAQHQLEHEQICPQAGWVEHDPLEIWERTKDVIH
GSVAKAGLVAADIAAIGITNQRETTMIWNRKTGQPYGNAIVWQDTRTDIVCNQMSAEGGQ
NRFQAKTGLPLATYFSGPKIRWMLDHYPGLRQDAEKGEALFGNMDSWLIWKLTGGPGPAA
VHVTDVTNASRTMLMNLKTLDWDEELLSAFAIPRAMLPSIRPSSDPEFYGFTRQDGPFGG
EIPICGDLGDQQAATVGQVCFDAGEAKNTYGTGCFMLMNTGTEMVHSNHGLLTTVCYQFG
HEKPHYALEGSVAIAGALVQWLRDRMRVINTAADIENLAKLVPDNGGMYFVPAFSGLFAP
YWRSEARGLIIGMTRFINRGHFARASLEAAAYQTREVVDAMQADSNVSLKVLKVDGGMTA
NDLLMQIQADVLGVPVVRPKVAESTALGAAYAAGLAIGYWKNSDDLCQNWGVDKSWKPSG
DDTLRTKNYAMWKKAVTRTFDWLDESA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaaatatgttgccgtgatcgatcagggcacaaccagcacacgctgcatggttttc
aacaaacagggtgaaattgtcgcccagcatcaattggaacatgaacagatctgtccgcaa
gccggctgggtcgaacatgatccgctggaaatctgggaacggaccaaggatgtcatccat
ggatctgtcgccaaggccgggctggttgccgccgatatagcggccatcggcattaccaac
cagcgtgaaacgacgatgatctggaatcgcaagaccggccagccctatggcaatgccatt
gtctggcaggatacgcgcacggatatcgtgtgcaaccagatgtctgccgagggcggccag
aaccgtttccaggccaagacgggcctgccgctcgccacttatttttcagggccgaagatc
cgctggatgctcgatcattatccgggcctgcgccaggatgcggaaaagggcgaggctcta
ttcggcaatatggattcctggctgatctggaaattgaccggagggcctgggcctgcggcc
gtgcatgtgacggatgtgaccaatgcttcccggaccatgctgatgaatctcaaaacgctc
gattgggatgaggaattgctgtcggccttcgctattccgcgcgccatgctgccgagcata
cggccgtcttcagatcctgaattctatggcttcacccgccaggatggcccttttggcggt
gaaatcccgatctgcggcgatcttggcgatcagcaggcggcgacggtcggacaagtctgt
ttcgatgcgggagaagccaaaaatacctatggcaccggctgtttcatgctcatgaatacg
ggcacggaaatggtccattcgaaccatgggctcttgacgacggtctgttatcaattcggc
catgagaagccgcattatgcactggaaggctcggtggcgattgccggcgccctggtccaa
tggctgcgcgatcgtatgcgcgttatcaatacggcggccgatatcgaaaacctggccaaa
ctcgttcccgataatggcggcatgtatttcgtgccggccttttccgggcttttcgctccc
tattggcgcagcgaggcgcgcggcctcatcatcggcatgacccgtttcatcaatcgcggc
cattttgcccgcgcgagcctggaagccgctgcctaccagacccgcgaagtggtggatgcc
atgcaggctgactccaatgtctcgctgaaagtcttgaaagtcgatggcgggatgaccgcc
aatgatcttttgatgcagatccaggctgatgttctgggtgtgccagtggtgcggccgaaa
gtggcggaaagcacggctcttggggccgcctatgcggctggccttgccattggctattgg
aagaatagtgacgacctgtgccagaattggggtgtcgacaagagttggaagccctcgggt
gatgatactttgcgcactaaaaattacgccatgtggaaaaaggccgtgacccgcaccttc
gactggctcgatgagagcgcgtga

DBGET integrated database retrieval system