KEGG   Beijerinckia indica: Bind_0435Help
Entry
Bind_0435         CDS       T00688                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bid  Beijerinckia indica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bind_0435
   00052 Galactose metabolism
    Bind_0435
   00500 Starch and sucrose metabolism
    Bind_0435
   00520 Amino sugar and nucleotide sugar metabolism
    Bind_0435
Enzymes [BR:bid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bind_0435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
490212..491099
Genome map
AA seq 295 aa AA seqDB search
MTTPIRKAVFPVAGLGTRFLPATKSVPKEMLTVVDRPVLQHVVDEAREAGIEHFIFVTGR
NKAVIEDHFDIAYELQDTLLKRNKIKEYDALIADLPKPGATSFTRQQAPLGLGHAVWCAR
DIVGHEPFAVLLPDMITLKDDGKGRCLAQCIAAYNKHGGNIIATEEVPADETHQYGVVGL
GKDYGDTFEITGMVEKPAKGTAPSNLIISGRYVLGPEIFEILEHGEKGAGGEIQLTDGMK
TLAESQAFHGVRFSGRTFDCGSKLGFLAANVAFALANPEIGPGFAADLKKIVGTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgccgattcgcaaagccgtttttcccgtcgccggtcttggcactcgatttctg
cccgctaccaaatctgttccgaaggaaatgctgaccgtggtcgatcggccggtcctccag
catgtggtcgatgaagcccgcgaagccggtattgaacatttcattttcgtcaccggccgc
aacaaggccgttatcgaagatcatttcgacattgcttatgagcttcaggacactttgctg
aagcgcaataaaattaaagaatatgacgctttgatcgctgatctgccgaagcctggcgcg
acgagcttcacccgccagcaagcgccgctgggtcttggtcatgccgtctggtgtgcccgc
gatattgtgggacatgaaccgtttgcggttctgttgccggatatgatcaccctaaaggat
gatggcaaaggccgttgccttgcgcaatgtattgcagcctataacaaacatgggggtaat
attatcgccacggaggaagtgcctgctgacgaaactcatcaatatggcgtcgtcgggctc
ggcaaggattatggcgatacgttcgagattaccggaatggtcgagaagccggccaagggg
accgcgccttccaacctgatcatctccggccgctatgtcctcggtcctgagattttcgag
attctcgaacacggggagaagggcgctggcggtgaaattcaattgaccgatggcatgaag
accttggctgaatcacaagcatttcacggtgtgcgtttcagcggcaggacgttcgattgc
ggctcgaaactgggtttcctcgctgccaatgtcgcttttgctctggccaatcccgagatc
ggtccgggtttcgccgccgatttgaaaaagattgtcggcactctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system