KEGG   Beijerinckia indica: Bind_0536Help
Entry
Bind_0536         CDS       T00688                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
bid  Beijerinckia indica
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bind_0536
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bind_0536
Enzymes [BR:bid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Bind_0536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(589747..591117)
Genome map
AA seq 456 aa AA seqDB search
MNSTSFFDLVASITERGRDLLARRLTAIDPEHNAKSLIELCEALLSERGEASGLAQAAEI
LERYLSLDEAERIALFTAFAEKFGPNRERLTKAAKAWLADPQHADAGDLHYYSESVRQEL
FRRLNRAPGGTHALVGMRADLITLLPQNKHLTPVDRDLAHLLAVWFNRGFLVLHRIDWST
PAIVLEKIIRYEAVHAIHDWADLRRRIDSLDRRCYGFFHPALIDEPLIFVEVALTEKMPA
AIGPLLAEDRTVVPLEKARTAVFYSISTCQRGLAGISFGNFLIKQVVEELRRELPNLTTF
VTLSPVPGFMQWLQTAENLPLTEEQRAILPSLKEPNWTEKPEEAEQLQKVIEPLAAYYFL
KIKRPDGRPRDPVARFHLGNGARLEQIRWLGDRSPRSLSEGAGLMVNYLYDLDDIEKNHE
AFVKTGEIITSSAIKKLLKSDPKPRPSTAALPQPRG
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcacttcgtttttcgatctggtcgcgtccatcacggagcggggccgcgatctt
cttgcccgtcgcctgactgcgatcgaccccgaacacaatgccaaaagcctgatcgaactc
tgtgaagccttgctgtctgaacggggcgaggcctccggtcttgcccaggccgccgaaatc
cttgaacgctatctcagcctcgacgaggcggaacgaatcgccttattcactgctttcgct
gagaaattcggccccaaccgagaacggttgaccaaagccgccaaggcatggctcgcggat
ccgcagcacgccgatgccggagacctgcattattattcagaatccgtgcggcaggagctg
ttccggcgcctcaatcgcgcccctggcggcacgcatgccctggtcggcatgcgggcggat
ctcatcactctcctgccccagaacaaacatctcacgcccgtcgatcgcgatctcgcgcat
ctgctcgccgtttggttcaatcgcggctttttggtgttgcaccggatcgactggtcgacc
cccgctatcgtgctcgagaaaatcatccgctacgaggccgtccatgcgatccatgattgg
gcggatttgcgccgccgcatcgattcactggaccggcgctgctatggctttttccatcca
gctttgatcgacgagcccttgattttcgtcgaagtcgccttgacggagaaaatgcccgcc
gccatcggcccgttgctggcggaggatcggactgtggttccgctcgaaaaggcgcgcacc
gccgtcttttattccatttcgacctgccaaaggggtcttgctggcattagtttcggcaat
tttctcatcaagcaggtggtcgaggagcttcgccgggaattgccgaatctcaccacattc
gtgacgctctcgcctgttcccggcttcatgcaatggctgcaaacggccgaaaacctgccc
ctcacagaggaacagcgcgccattctgccgagcctcaaggaaccgaattggacggagaag
ccggaagaagccgaacagctccaaaaggtcattgaacccctggcggcctattattttctc
aagatcaagcgccctgatggccgtccacgcgatccggtcgcccgttttcatcttggcaac
ggggcaaggctcgagcaaattcgctggctcggcgaccgttccccgagaagcctgagcgag
ggcgcggggctgatggtcaattacctttacgatctcgacgatatcgagaaaaaccacgag
gctttcgtcaagaccggcgagatcatcacgtcgagcgcgataaagaaattattgaaatcc
gacccgaaaccgcgtccgtccacggcggccctacctcaacctcgcggctaa

DBGET integrated database retrieval system