KEGG   Beijerinckia indica: Bind_0831Help
Entry
Bind_0831         CDS       T00688                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bid  Beijerinckia indica
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Bind_0831
Enzymes [BR:bid01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bind_0831
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Bind_0831
Lipid biosynthesis proteins [BR:bid01004]
 Fatty acid synthase
  Component type
   Bind_0831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
929582..930328
Genome map
AA seq 248 aa AA seqDB search
MKRTNEIATDAVRTVVHEATNKAADADATFAAYKQRRHFLQSTAGLFAAIALGMSGKGWA
ATNPLKIVALGDSLTAGYLLPAQAAFPVVLEKALRNQGYDVRLINAGVSGDTAAGGLARL
DWSLGEGVDGVIVELGANDMLRGIDPASTRATLAEILTRLRQRRIKALLAGMRAAPNLDA
LYREQFEAIYPALAQQFDVPFYPFFLDGVAGNPALELPDRVHPNQEGVERIVEKFLPLAE
RFVQSLGS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaccaacgagattgcgaccgatgcggtgaggacggtagtccatgaggcgaca
aacaaggcggctgatgccgacgccacctttgccgcatataagcagcgacggcattttctc
caatccacggcgggccttttcgcagccatcgcccttggcatgagcggaaaaggctgggcc
gcgacaaacccgctcaaaatcgtcgccctgggtgatagtctgaccgccggctatctcttg
ccagcccaggcggcgtttccggtggtgcttgaaaaagccttgcggaaccaagggtatgac
gtgcggctgatcaatgccggtgtctccggcgatacggcggcgggcgggcttgcccgcctc
gattggagccttggcgagggcgtcgatggcgtgattgtcgagctgggcgccaatgatatg
ttgcgggggatcgatccagcgtcgacacgcgcgaccttggccgagatcctgaccaggctg
cggcagcgtcgaatcaaggccctgctcgcaggcatgcgggcggcacccaatctcgatgcc
ctttatcgggaacaattcgaggcgatttatcctgctctcgcacagcagttcgatgtacca
ttctatccgtttttcctggacggcgtggcgggtaatccagcgctggaactgcccgatcgc
gtgcatcccaatcaagagggcgtggaacggatcgtcgagaaatttttgcccctggctgag
cgtttcgtgcaaagcttgggaagttga

DBGET integrated database retrieval system