KEGG   Beijerinckia indica: Bind_0865Help
Entry
Bind_0865         CDS       T00688                                 

Definition
glycoside hydrolase family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bid  Beijerinckia indica
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bind_0865
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Bind_0865
Enzymes [BR:bid01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bind_0865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
985645..986757
Genome map
AA seq 370 aa AA seqDB search
MLQNIRARNSIAEVGTHFLVGLRPTPELHDQDRALLADLRPAGVILYKSNFRHDLPYAQW
LEIHARLIEDIYAACGREHLWIGIDHEGGRVCRTPAPITRFAYAAHWGDCAAAVGQAMGC
ELASLGINLNFAPVLDIHTNPANPVIGERAFATTPEAVTPLALGFLRAMQAENVLGCGKH
FPGHGDTSVDSHYGLPSQNCSLEDLRQRELKPFIAAIEAGLSMIMTSHILFPAIDPDFPV
TLSRRFCTELLREELGYSGVVVSDDIGMGAMNQFFAEPTAAARLIAAGCDLLMVCAHWTE
TERVRDFAESIVRARDKGEITPDQLTVSKVRIDGLLSQAPRNPVRTLAPQIFARHAEAGP
LFAAKTVEVI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgctccagaatatccgcgcccgaaattccattgctgaagtcggcactcattttctcgtt
ggtctgcggccgacgccagaactgcatgatcaggatcgggccttgctggctgatctgcgg
ccggcaggggtcatcctctataaaagcaattttcggcatgacctgccttatgcgcaatgg
ctcgaaatccatgcgcggctcatcgaagacatttacgcggcttgcggtcgggagcatctc
tggatcggcatcgaccatgagggtggccgggtgtgccggacgccggcgccaatcacgcgt
tttgcctatgcggcgcattggggcgattgtgccgccgccgtggggcaggcgatgggctgc
gaactcgcctcgctcggcatcaatctgaatttcgcaccggtcctcgacattcacactaat
ccggccaatcccgtgatcggcgagcgggccttcgccacgacgcccgaggcggtgacgccg
ctggcgcttggtttcctgcgggccatgcaggcggaaaatgttctcggctgcggcaagcat
tttccagggcatggcgacacatcagtcgattcgcattatggcctgccgagccagaattgt
agcctcgaagatttgcggcagcgtgaattgaagcccttcatcgccgcaatcgaggccggc
ctttcgatgatcatgacctcgcatattctgtttccggcgatcgatcccgattttccggtg
acgctttcgcggcgtttctgcactgaactgttgcgcgaggaattgggctattccggcgtc
gtcgtttcggacgatatcggcatgggtgcgatgaatcagttttttgccgagcccacggcc
gccgcgcgtctcatcgcggcgggctgcgatcttctcatggtctgcgcccattggaccgag
acggagcgggttcgggatttcgcggaaagcattgtgcgggcgcgcgataaaggtgagatc
acacccgatcaactgaccgtatcaaaggtgcggatcgatggtttgctcagccaggcgccg
cgcaatcctgtacggactctggcccctcagattttcgcgcgccatgcagaagctggccct
ctgttcgcggccaagacggtcgaggtgatttaa

DBGET integrated database retrieval system