KEGG   Beijerinckia indica: Bind_1450Help
Entry
Bind_1450         CDS       T00688                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bid  Beijerinckia indica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bind_1450
   01230 Biosynthesis of amino acids
    Bind_1450
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bind_1450
   00051 Fructose and mannose metabolism
    Bind_1450
   00562 Inositol phosphate metabolism
    Bind_1450
Enzymes [BR:bid01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bind_1450
Exosome [BR:bid04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bind_1450
  Exosomal proteins of bladder cancer cells
   Bind_1450
  Exosomal proteins of melanoma cells
   Bind_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1659311..1660069
Genome map
AA seq 252 aa AA seqDB search
MTKTLRPLIAGNWKMNGLRKDLDEIAAIRDGGVKVGGAVEIVVCPPFTLLAAAASLCEGS
GIGIGGQDCHPEKKGAFTGDIAPPMLKDCGATYVILGHSERRLIHGESDALIRDKIKGVQ
AAGLAAILCVGETAEQRSTGQALAVVGEQLAGSIPRDVSIEGLVIAYEPVWAIGTGLTPT
AEDIAEMHGFIRAKLEESWPGKAATVRLLYGGSVKPSNAAKLLAIANVDGALIGGASLIA
ADFLAIAAACPV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaacattacgcccgcttatcgcgggaaattggaagatgaatggcctgcgcaag
gatctcgacgaaattgccgctatccgggatggcggcgtgaaagtggggggagcggtggag
atcgtggtctgccctccattcaccttacttgcggcggctgccagcctttgcgaaggctcc
gggatcggcatcggcggacaggactgccatccggagaaaaagggcgccttcacgggggat
atcgcgccgcccatgctcaaggattgcggcgccacttacgtgattctgggccattccgaa
cgccgtctcatccatggcgaatccgatgccttgattcgtgacaagatcaagggggtacaa
gcggctgggctcgcggcgatcttgtgcgtcggcgaaacagcggagcaaaggagtaccggc
caggcgcttgcggtcgttggcgaacaattggcgggatcgatcccgcgtgatgtttcgatc
gagggcctggtcatcgcctatgaaccggtctgggccatcggcaccggtttgacgccgacc
gcggaggatatagccgaaatgcatggcttcatccgtgcgaaactcgaagaaagctggccg
ggcaaggccgcaacagtgcggttgctctatggtggctccgtcaaaccgagcaatgccgcc
aaattgctcgccatcgccaatgtcgatggcgcgttgatcggtggcgccagtcttattgcg
gcggattttctggcgatcgcggcggcctgtcccgtgtga

DBGET integrated database retrieval system