KEGG   Beijerinckia indica: Bind_1503Help
Entry
Bind_1503         CDS       T00688                                 

Definition
putative alkaline phosphatase (PhoD); putative signal peptide
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bid  Beijerinckia indica
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bid00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bid00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bid02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1702605..1704173
Genome map
AA seq 522 aa AA seqDB search
MRLLPTRRAFLGGAGVMLLAPGRIVAPALSRAADRPKITHGSQSGDVTTESGVVWARADR
PSQMLVEIATRESFKDARALPPVDALPETDYAAKLLVEDLPADQTIFYRVRFRDLAEINV
ESEPLIGRFRTAPTARRTISFVWGGDVAGQGYGINLADGGMKTYASMRETQPDFFIHSGD
TIYADGVMQPETRLPDGSLWKNDLLVEAKTRVAETLDDFRANHLYNMQDENVRAFAAEVP
IFVQWDDHEVTNNWSLSKQLGPAYQEKSISLLAARSRRAFHELYPLRESAVELGRVYRKI
AYGPLLDVFMLDERSYRGPNGANRQKTYGPEAYFLGPEQLAWLKRELLASRAVWKVIASD
MPLSLIVYDDAAARRGSEAFAQGDGPPLGRELEIADLLRFIKAAPIRNTVWLTADVHYTA
AHHYDPSRAQFQDFDPFWEFVSGPIHAGTFGPNELDNTFGPEVRFMKAPPQGQSNLAPSA
GYQFFGHVTVDGVTGQMTVRLKDRANTDLWSVTLDPAESEAG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttcttccgacacgccgtgcttttctgggcggcgccggtgtcatgcttcttgcg
ccagggagaattgttgccccggctttgtcgcgcgcggcggatcggccgaaaataacccat
ggttcgcagtcgggcgatgtcacgaccgagtcaggtgtggtctgggcgagagctgatcgg
ccttcgcaaatgctggtcgagatcgcgacgcgggaaagtttcaaggacgctcgcgctttg
ccgccggtggatgcgctgccggaaacggattacgcggccaagcttcttgtcgaggatctg
ccggccgaccagacgattttctatcgcgtgcgtttccgcgatctcgccgagatcaatgtt
gaaagcgagcctctgatcgggcgttttcgcacggcgcccaccgcgcggcgcacaatcagt
ttcgtctggggcggcgatgtggcggggcagggctatggcatcaatctcgccgatggcggc
atgaagacttatgcatccatgcgcgaaacacagccggatttcttcatccattccggcgat
acgatctatgccgatggagtgatgcagccggagacgcgcctgcctgatggcagtttgtgg
aagaatgatcttctggtcgaggcgaaaacccgcgtggccgaaacgctcgacgatttccgg
gccaatcatctctacaatatgcaggatgagaacgtccgtgccttcgcggctgaagtgccg
atcttcgtccaatgggacgatcacgaagtcaccaataattggtctctttcgaagcaactg
ggtccggcttatcaggaaaagtcgatcagcctgctagccgcgcgctcgcggcgcgccttc
catgagctttatcccttgcgggaaagtgccgtggagcttggtcgcgtctatcgcaagatc
gcttatggccctctgctcgatgtgttcatgctggatgagcggtcctatcgcggaccgaat
ggcgcaaaccgccaaaaaacctatggaccggaagcctattttctcggtccggaacagctt
gcctggctgaaacgtgagcttctggcctcgcgagcggtctggaaagtcatcgcctccgac
atgccgctcagcctcattgtctatgatgatgcggccgcacggcgtggatcggaagctttt
gcccagggcgatgggccgccgctcggccgtgagctcgaaatcgccgatcttctgcgcttc
atcaaggcggcgccgatccgaaatacggtctggctcaccgccgatgtgcattatacggcg
gcgcatcattacgatccctcacgcgcccaatttcaggatttcgatcctttctgggaattc
gtctcggggccgattcatgccgggactttcggaccgaatgagctcgacaacacttttggg
ccggaagtgcgtttcatgaaggcgccgccgcaagggcagagcaatctcgcgccttctgcc
ggctaccaattcttcggccatgtgacggtggacggcgtgacgggtcagatgacggtcagg
ttgaaggatcgcgccaacacggatctttggagcgtgacgcttgatccggctgaatcggaa
gcgggctga

DBGET integrated database retrieval system