KEGG   Beijerinckia indica: Bind_1507Help
Entry
Bind_1507         CDS       T00688                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bid  Beijerinckia indica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bind_1507
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bind_1507
   00020 Citrate cycle (TCA cycle)
    Bind_1507
   00620 Pyruvate metabolism
    Bind_1507
Enzymes [BR:bid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bind_1507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1707450..1708808
Genome map
AA seq 452 aa AA seqDB search
MSINILMPALSPTMEQGKLAKWLKKEGDKIKSGDVLAEIETDKATMEVEAVDEGILAKII
IPDGTEQVAVNTPIAIIAEDGEDAAAVAAKGAGAPAAAPPAAASPAAAPAPAPAPTPAAA
PVAAAAPAAAPVAANGARVFASPLARRLAKEGGLDLTAVAGSGPHGRIIERDVKAAIAAG
PQPKAAPAPAAAPAPVAASARAPSVGMSDETIKKFFPAGSYEELPHDSMRKTIARRLVEA
KQTIPHFYLSVDCELDALMALREQVNASAAKDKEGKPAFKVSVNDFIIKGLALALIQVPD
TNVTWTEGAMLRHKHADVGVAVSIPGGLITPIIRSADTKSLSAISNEMKDYAARAKARKL
KPEEYQGGTSAVSNLGMFGIKNFQAVINPPHATILAVGAGEQRVVVKNGAPAVATLMTAT
LSTDHRAVDGVLGAQLLGAFKSLIENPMGMLV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcaatatcctcatgcccgcgctttctccgaccatggagcaaggcaagctcgcc
aaatggctcaagaaggaaggcgataagatcaaatcgggcgatgtcctggccgaaatcgaa
accgataaggcgacgatggaagtcgaggccgtcgacgaaggcattctggccaagatcatc
attcccgacggaacggaacaggtcgccgtcaatacgccgatcgccatcatcgccgaggat
ggtgaagatgccgccgccgtcgctgccaaaggggcaggggcacccgctgcggcgccgccc
gccgccgcgagcccggccgctgccccagcgccggctccagcacccaccccggctgcggct
cccgtggccgctgccgcgcctgcagccgctcctgtggctgccaatggtgcgcgtgtcttt
gcctcgccactggcccgtcgtctcgccaaggaaggcggtcttgatctcacagcggttgcg
ggttcgggtccgcatggccgcatcatcgaacgcgatgtgaaagccgcgatcgccgctgga
ccgcagccgaaagcagcgccggctccggctgctgctcccgctccggtggccgcctccgct
cgggccccctcggtgggtatgtccgacgagacgatcaagaaattctttcccgccggctcc
tatgaagagcttccgcatgattccatgcggaaaaccattgcccgccgcctcgtcgaggcg
aagcagacgatcccgcatttctatctgtccgtcgattgcgaactcgatgcgctgatggct
ttgcgcgagcaggtcaatgcctcggcggcgaaggacaaggagggcaagccggccttcaag
gtttcggtcaatgatttcatcatcaagggcctggcgctcgccttgatccaggtgcccgat
accaatgtgacctggaccgaaggggccatgctgcgccacaaacatgccgatgtcggcgtg
gccgtctcgatccctggtggtctcatcacgccgatcattcgctcggccgataccaagagc
ctgtcggcgatctccaatgaaatgaaggattacgccgcccgcgccaaagcccgcaagttg
aagccggaggaatatcagggcggcacttcggcggtgtccaatctcggcatgttcggcatc
aagaatttccaggcggtcatcaatcctccgcatgcgacaattcttgcggttggtgccggc
gagcagcgcgtcgttgtcaagaacggggctccggctgttgcgaccttgatgaccgcgacg
ctctcgaccgatcaccgtgcggtggacggcgtgcttggcgcgcaattgctgggcgccttc
aagagcctgatcgaaaacccgatgggcatgctcgtttga

DBGET integrated database retrieval system