KEGG   Beijerinckia indica: Bind_1507Help
Entry
Bind_1507         CDS       T00688                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bid  Beijerinckia indica
Pathway
bid00010  Glycolysis / Gluconeogenesis
bid00020  Citrate cycle (TCA cycle)
bid00620  Pyruvate metabolism
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01120  Microbial metabolism in diverse environments
bid01130  Biosynthesis of antibiotics
bid01200  Carbon metabolism
Module
bid_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bind_1507
   00020 Citrate cycle (TCA cycle)
    Bind_1507
   00620 Pyruvate metabolism
    Bind_1507
Enzymes [BR:bid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bind_1507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACB95140
JGI: Bind1507
UniProt: B2IB56
Position
1707450..1708808
Genome map
AA seq 452 aa AA seqDB search
MSINILMPALSPTMEQGKLAKWLKKEGDKIKSGDVLAEIETDKATMEVEAVDEGILAKII
IPDGTEQVAVNTPIAIIAEDGEDAAAVAAKGAGAPAAAPPAAASPAAAPAPAPAPTPAAA
PVAAAAPAAAPVAANGARVFASPLARRLAKEGGLDLTAVAGSGPHGRIIERDVKAAIAAG
PQPKAAPAPAAAPAPVAASARAPSVGMSDETIKKFFPAGSYEELPHDSMRKTIARRLVEA
KQTIPHFYLSVDCELDALMALREQVNASAAKDKEGKPAFKVSVNDFIIKGLALALIQVPD
TNVTWTEGAMLRHKHADVGVAVSIPGGLITPIIRSADTKSLSAISNEMKDYAARAKARKL
KPEEYQGGTSAVSNLGMFGIKNFQAVINPPHATILAVGAGEQRVVVKNGAPAVATLMTAT
LSTDHRAVDGVLGAQLLGAFKSLIENPMGMLV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcaatatcctcatgcccgcgctttctccgaccatggagcaaggcaagctcgcc
aaatggctcaagaaggaaggcgataagatcaaatcgggcgatgtcctggccgaaatcgaa
accgataaggcgacgatggaagtcgaggccgtcgacgaaggcattctggccaagatcatc
attcccgacggaacggaacaggtcgccgtcaatacgccgatcgccatcatcgccgaggat
ggtgaagatgccgccgccgtcgctgccaaaggggcaggggcacccgctgcggcgccgccc
gccgccgcgagcccggccgctgccccagcgccggctccagcacccaccccggctgcggct
cccgtggccgctgccgcgcctgcagccgctcctgtggctgccaatggtgcgcgtgtcttt
gcctcgccactggcccgtcgtctcgccaaggaaggcggtcttgatctcacagcggttgcg
ggttcgggtccgcatggccgcatcatcgaacgcgatgtgaaagccgcgatcgccgctgga
ccgcagccgaaagcagcgccggctccggctgctgctcccgctccggtggccgcctccgct
cgggccccctcggtgggtatgtccgacgagacgatcaagaaattctttcccgccggctcc
tatgaagagcttccgcatgattccatgcggaaaaccattgcccgccgcctcgtcgaggcg
aagcagacgatcccgcatttctatctgtccgtcgattgcgaactcgatgcgctgatggct
ttgcgcgagcaggtcaatgcctcggcggcgaaggacaaggagggcaagccggccttcaag
gtttcggtcaatgatttcatcatcaagggcctggcgctcgccttgatccaggtgcccgat
accaatgtgacctggaccgaaggggccatgctgcgccacaaacatgccgatgtcggcgtg
gccgtctcgatccctggtggtctcatcacgccgatcattcgctcggccgataccaagagc
ctgtcggcgatctccaatgaaatgaaggattacgccgcccgcgccaaagcccgcaagttg
aagccggaggaatatcagggcggcacttcggcggtgtccaatctcggcatgttcggcatc
aagaatttccaggcggtcatcaatcctccgcatgcgacaattcttgcggttggtgccggc
gagcagcgcgtcgttgtcaagaacggggctccggctgttgcgaccttgatgaccgcgacg
ctctcgaccgatcaccgtgcggtggacggcgtgcttggcgcgcaattgctgggcgccttc
aagagcctgatcgaaaacccgatgggcatgctcgtttga

DBGET integrated database retrieval system