KEGG   Beijerinckia indica: Bind_1576Help
Entry
Bind_1576         CDS       T00688                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bid  Beijerinckia indica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bid00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1779032..1779673
Genome map
AA seq 213 aa AA seqDB search
MDDVVKSLLQRTTSSLTKPAPARPSREEAEAAVEVLLRWTGDDPSREGLRDTPKRVVKAF
EEFFSGYNADASDVLSRVFEEVHGYDNMVLVRDIPFSSHCEHHMVPFFGVAHIGYYPSEA
GVIGLSKLARLVDIFAKRLQTQEALTAQIIGAIDEHLQPRGCAIMLEAEHMCMSMRGVQK
HGTSTLTTQFTGVFKNDPAEQVRFFGMVRNPKS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggatgacgtggttaagtccttactccaaagaacgacttcttccttgaccaaacctgct
cctgcccgtccctctcgcgaagaggccgaggccgccgtcgaagtgctgttgcgctggacg
ggcgatgatccatcccgcgagggtttgcgcgatacgccaaagcgcgtcgtcaaggctttc
gaggaattcttctccggctataacgccgacgcgtccgatgtcctttcgcgcgtcttcgag
gaggtgcacggctacgacaatatggtgctcgtgcgggacattcctttctcgtcccactgc
gagcatcatatggtgcccttcttcggggtcgcccatatcggctattatccttcggaagcc
ggtgtgatcgggctttcgaagctcgcccgcctggtcgatattttcgccaagagattgcag
actcaagaggctttgaccgctcagattattggggcgatcgacgagcatttgcagccccgc
ggctgcgccattatgcttgaggcggaacatatgtgcatgtcgatgcgcggagtgcaaaaa
cacggcacatctacgctcacaacgcaatttacaggtgttttcaaaaacgatccggccgag
caggttcgcttcttcggcatggtccgcaacccgaagagttga

DBGET integrated database retrieval system