KEGG   Beijerinckia indica: Bind_1579Help
Entry
Bind_1579         CDS       T00688                                 

Definition
phosphoribosyl-AMP cyclohydrolase (EC:3.5.4.19)
Orthology
K01496  
phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
bid  Beijerinckia indica
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bid01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bid00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1781250..1781708
Genome map
AA seq 152 aa AA seqDB search
MTMPAAVFPSADSKADLEEGTRFTPRFDKDGLITCVTLDVRDGQILMLAHMNAESLRLTL
ETGEAYYWSRSRQKLWRKGETSGQIQKVKAIHTDCDQDALLLSVEPGGDGGACHTGRRSC
FYRRVIAGEKGTGLVFEEETTADVSAKEHPAH
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgccggcggcggttttccccagcgcagacagcaaggcggaccttgaggaaggg
acgaggttcacgccgcgtttcgacaaggatggtctgatcacctgtgtgacattggacgtg
cgtgacggccagatcctgatgctcgcccatatgaatgccgaatcgctccggctcacgctg
gaaacgggagaggcctattattggtcacgctcacggcaaaaattgtggcgcaagggtgag
acctctggtcagattcagaaggttaaggcgattcacaccgattgtgaccaggacgcgctg
cttctcagcgtcgagcccggcggcgatggcggagcttgtcatacggggcggagaagttgt
ttctatcgccgcgtcatcgcgggtgagaaaggaaccgggctagttttcgaggaggagacc
acagccgatgtttcagcaaaagagcatcccgctcactga

DBGET integrated database retrieval system