KEGG   Beijerinckia indica: Bind_1579Help
Entry
Bind_1579         CDS       T00688                                 

Definition
(GenBank) Phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
bid  Beijerinckia indica
Pathway
bid00340  Histidine metabolism
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Bind_1579
Enzymes [BR:bid01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     Bind_1579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: ACB95211
JGI: Bind1579
UniProt: B2IBC7
Position
1781250..1781708
Genome map
AA seq 152 aa AA seqDB search
MTMPAAVFPSADSKADLEEGTRFTPRFDKDGLITCVTLDVRDGQILMLAHMNAESLRLTL
ETGEAYYWSRSRQKLWRKGETSGQIQKVKAIHTDCDQDALLLSVEPGGDGGACHTGRRSC
FYRRVIAGEKGTGLVFEEETTADVSAKEHPAH
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgccggcggcggttttccccagcgcagacagcaaggcggaccttgaggaaggg
acgaggttcacgccgcgtttcgacaaggatggtctgatcacctgtgtgacattggacgtg
cgtgacggccagatcctgatgctcgcccatatgaatgccgaatcgctccggctcacgctg
gaaacgggagaggcctattattggtcacgctcacggcaaaaattgtggcgcaagggtgag
acctctggtcagattcagaaggttaaggcgattcacaccgattgtgaccaggacgcgctg
cttctcagcgtcgagcccggcggcgatggcggagcttgtcatacggggcggagaagttgt
ttctatcgccgcgtcatcgcgggtgagaaaggaaccgggctagttttcgaggaggagacc
acagccgatgtttcagcaaaagagcatcccgctcactga

DBGET integrated database retrieval system