KEGG   Beijerinckia indica: Bind_1613Help
Entry
Bind_1613         CDS       T00688                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bid  Beijerinckia indica
Brite
Enzymes [BR:bid01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Bind_1613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1820462..1821736
Genome map
AA seq 424 aa AA seqDB search
MHYCLSAFAGLILFMAVGAIIDSFGQDSLAQENPQGGMTRATAYQQARQLSEIGRQMFSD
PRLSGSGKLSCASCHDPQNAFSPSNDLAVQMGGKTLDRAAFRAAPTLTYKQVTPPSTEHY
YESDEEADGSIDNGPTGGLTWDGRVDRRSDQALIPLLSPLEMANEDRAALSDTIEKIYGQ
ALRAVAGGLVSQDKQWPLEAAMKALDAFQQEGALFYPFSSKYDAFLRGKAELSEQEKHGL
EIFTAEDKGNCASCHVSAPSKTGTPPFFTDYGLIAIGVPRNRDIAQNQDPAFFDLGLCGP
ERQDFRDRPDYCGLFKTPTLRNVARRKVFFHNGVVKSLREAVAFYFERDTKPEKYYPHGA
DGTIAKYDDLPAAYHDNVNNEPPFGKQAGDPSTVSEADIDAVVAFLKTLDDGFSSQEPAA
VKYP
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcattattgtctctctgcctttgctggtctgattttatttatggctgttggagccatt
attgacagttttgggcaagacagtttggcgcaagaaaatccgcaaggaggaatgaccaga
gcgacggcctatcaacaggcgaggcaattgtcggagatcggccggcagatgttttccgat
cccagactgtcgggctcgggtaaattgtcctgcgcttcctgccatgatccccagaatgct
ttttcgccctccaatgaccttgctgtgcaaatgggcggcaaaaccctcgatcgagccgcg
tttcgcgcggctccgacgctcacctataaacaggtgaccccgccgtccacggaacattat
tatgaatccgacgaggaagctgacggcagcatagacaatggtccaacgggcggcttgacc
tgggatggccgcgtggatcggcgctcggaccaagccttgatccctcttttatcgccgctt
gaaatggcgaatgaagatcgtgcggcgctgtccgatacgatcgaaaaaatttacgggcaa
gccttgcgcgctgtggcaggcggattggtgtcgcaagacaagcaatggcccctcgaagcg
gcgatgaaggcgcttgacgcctttcagcaggagggcgcgctcttctatcccttctcaagc
aaatatgatgcttttctgcgcggcaaggcggaattgagcgagcaggaaaaacacgggctc
gaaattttcacggcagaggacaagggtaattgcgcaagctgccatgtcagcgcgccgagc
aagacgggcaccccgcccttcttcactgattatgggttgattgcgatcggcgtgccgcgc
aatcgcgacatagcgcaaaatcaagatccggcttttttcgatctcggtctttgtggtccc
gagcgacaggatttccgtgacaggccggattattgcggcctgttcaagacgccgaccctc
cgcaatgtcgcccgcagaaaagtcttcttccacaatggtgtcgtgaagagcttgcgcgag
gccgtcgccttctatttcgaacgcgatacgaagccggagaaatattatccccacggcgcc
gatggaacgattgccaaatatgacgatctgcccgctgcttaccatgacaatgtcaataat
gagcccccctttggtaaacaggccggagacccttcgacggtctcggaagccgacattgat
gcggtggtcgcctttctcaaaaccctggacgatggcttctcgagccaggaacccgctgcg
gtgaagtatccgtaa

DBGET integrated database retrieval system