KEGG   Beijerinckia indica: Bind_1898Help
Entry
Bind_1898         CDS       T00688                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bid  Beijerinckia indica
Pathway
bid00620  Pyruvate metabolism
bid00630  Glyoxylate and dicarboxylate metabolism
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01120  Microbial metabolism in diverse environments
bid01200  Carbon metabolism
Module
bid_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bind_1898
   00630 Glyoxylate and dicarboxylate metabolism
    Bind_1898
Enzymes [BR:bid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bind_1898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ACB95522
JGI: Bind1898
UniProt: B2IEC4
Position
2163535..2165718
Genome map
AA seq 727 aa AA seqDB search
MGYLSINGLSVDSELHDFIVKEAIPGSGVSAEQFWTGLADLVAAKSATNRALLAKRDELQ
AKIDAYYRSGGSKDPAATEAFLREIGYLLPEPAPQAIETQNVDDEIATIAGPQLVVPGSN
ARYALNAANARWGSLYDALYGTDAIPETNGAERGKGFNPTRGALVVAKAKTILDQSVPLD
GASYADVTAYQIEGSTLKATTKDGKSIGLKTPEQFAGFTGTKEAPATILLRHNHLHFELV
VNANHPVGKTDPAGLADVIIESAVSTIIDMEDSVAVVDAADKVALYRNILGLMQGTLSDT
FVKNGASLTRTLHDDRIYQTGDGGTLRLHGRSLLLIRNVGHHMFTDAVLDASGAEIPENM
LDGMVTALVARHDLYGTHEHHNSRKGSVYIVKPKMHGPQEVAFANSVFEHIELAIGLPAN
TLKIGIMDEERRTTVNLMAGIQAASKRIVFINTGFLDRTGDEIHTAMEAGPMVRKNSIKN
EAWLKAYEDNNVDVGLASGLPGHAQIGKGMWAAPDAMADMLTQKIGHPRAGANTAWVPSP
TAATLHALHYHEVDVFERQKELAGRPRAKLHDLLTVPVAKTTYSAQEIQEELDNNAQGLL
GYVVRWIDQGVGCSKVPDIHNVALMEDRATLRISSQHIANWLYHKIVTESQVLETLKRMA
VVVDQQNAGDSAYRPMAPAFDGIAFKAACDLVFKGREQPNGYTEFLLHSRRREVKAEQAQ
SGQASAA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgggttatctttcgatcaacggcctttcggtcgattcggaacttcacgattttatcgtc
aaggaagctattcccggctctggcgtcagcgccgaacaattttggactggccttgccgat
ctcgtcgccgcgaaaagcgcgacgaaccgcgccttgctcgccaagcgcgatgaattgcag
gccaagatcgatgcttattatcgctccggcggctcaaaggatccggctgcgacggaagcc
ttcctgcgcgagatcggctatcttctgcccgagcccgcgccccaggcgatcgagacgcaa
aatgtcgacgatgaaatcgccacgatcgccgggccacagctcgtcgtgccgggctccaat
gcccgctatgcgctgaatgccgccaatgcccgttggggcagcctctatgacgcgctctat
ggcacggatgcgattccggaaaccaatggcgcggagcgcggcaagggtttcaaccccacg
cgtggcgcgctcgtcgtcgccaaggccaagaccattctcgaccagtccgtgccgcttgac
ggcgcgtcctatgcggatgtcacggcctatcagatcgaggggagcaccctgaaggccacg
acgaaggatggcaagagcatcggcctgaagacgcccgagcaattcgctggtttcaccggc
accaaggaagcgccagccaccatccttttgcgtcataaccatctccatttcgagctcgtc
gtcaatgccaaccatccggtcggcaagacggatccggccggcctcgccgatgtcatcatc
gagtccgccgtgtcgaccatcatcgacatggaagacagtgttgccgtggtcgatgccgcc
gataaagtggcgctttatcgcaatattctcggcctgatgcagggcacgctttcggacaca
ttcgtcaagaatggcgcttcgctgacccgcaccctgcatgacgatcggatctaccagact
ggcgatggcggcaccttgcgcctgcatgggcgcagcctgctgctcatccgcaatgtcggc
catcatatgttcaccgacgcggtccttgatgcgtcgggtgccgaaatcccggaaaatatg
ctcgacggcatggtgacagcgcttgtcgcgcgccatgatctttatggcacccatgaacac
cataacagccgcaagggttcggtctatatcgtcaagcccaaaatgcatgggccacaggaa
gtggcttttgccaattccgtgttcgaacatatcgaactggcgatcggtctgcccgcgaat
acgctgaagatcggcatcatggacgaggaacggcgcacgaccgtcaatctgatggcgggg
atccaagcggcctccaagcgtattgtcttcatcaatacgggcttcctcgatcgcaccggc
gacgaaatccatacggcgatggaagccggccccatggtgcgcaagaacagcatcaagaac
gaagcctggctgaaagcctatgaagacaataatgtggatgtcggcctggcgagtggcctg
cccggccatgctcagatcggcaagggcatgtgggccgctcccgatgccatggccgatatg
ctgactcagaagatcggtcatccgcgcgccggcgccaatacggcctgggtgccctcgccc
accgccgcgaccttgcatgcgcttcactatcatgaagtggatgtcttcgagcggcagaag
gaactggctggacggccgcgtgccaaactgcatgatcttctaaccgtgccggtcgccaaa
acgacctattctgcgcaggagattcaggaagagctcgacaataacgcccagggtctgctc
ggctatgtcgtgcgctggatcgaccagggcgtcggctgttcgaaagtgccggacattcac
aatgtcgccttgatggaagatcgcgcgaccttgcggatttccagccagcatattgccaac
tggctatatcacaagatcgtcaccgagagccaagtcctggaaaccctgaagcgcatggcg
gtcgtcgtcgatcagcagaatgccggcgattccgcctaccggccgatggcacccgccttc
gacggcatcgctttcaaagcggcctgcgatctcgtctttaagggacgtgaacagccaaac
ggctatacggaattcctgctgcattcacgccgtcgcgaggtcaaggccgaacaggcccaa
agtggccaagcctctgcggcttaa

DBGET integrated database retrieval system