KEGG   Beijerinckia indica: Bind_1988Help
Entry
Bind_1988         CDS       T00688                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bid  Beijerinckia indica
Pathway
bid00260  Glycine, serine and threonine metabolism
bid00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01130  Biosynthesis of antibiotics
bid01230  Biosynthesis of amino acids
Module
bid_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bind_1988
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bind_1988
Enzymes [BR:bid01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bind_1988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth IMPDH
Motif
Other DBs
NCBI-ProteinID: ACB95611
JGI: Bind1988
UniProt: B2IF46
Position
complement(2272110..2272943)
Genome map
AA seq 277 aa AA seqDB search
MPTRIDRRFEELAKAGRAGLVTFVMAGDPDLSTSLEILHALVRAGADVLEVGMPFTDPMA
DGPAIQAAGLRALKAGMTLRKTLDMVAAFRAKDATTPIILMGYYNPIYIFGVEAFLNRAK
EVGVDGLIVVDLPPEEDEELCLPARAAGLNFIRLATPTTDAVRLPAVLANTSGFLYYVSI
TGITGAGVPDYSKVASAVAGIKAHTNLPVAVGFGVKTAESARTIACHADAVVVGSAIVDA
LRASLDGEGRATPACIGTVEKLVAELAEGVRSAAAAA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcccacacgcatcgatcgccgcttcgaggaattggccaaggccggccgtgccgggctt
gtgactttcgtgatggccggcgatccggatctgtcgacttctctcgagattttgcacgcc
ctggtgcgggcgggtgcggatgtgctcgaggtcggcatgcctttcaccgatcccatggct
gatgggccggcgatccaggcggcgggcttgcgggcgctcaaggctgggatgaccttgcgc
aagaccctcgacatggtcgcggctttccgcgcgaaggacgcgacaaccccaatcattttg
atgggctattataatccgatctatatcttcggggtggaggctttcctgaaccgggccaag
gaagtcggcgtggatggtctcatcgtcgtcgatctgcctcccgaggaggatgaggaacta
tgccttccggcgcgggcggccgggctgaattttatccggcttgccacaccaacgaccgat
gctgtgcgcctgcctgccgtgctcgccaatacgtcgggtttcctctattatgtgtcgatc
actgggatcacaggcgcaggggtccctgattacagcaaggttgcttccgcggttgccggc
atcaaggcgcatacgaatctaccagttgccgttggtttcggcgtcaagacggcggaaagc
gcgcgtacgatcgcgtgccatgccgatgccgttgtcgtggggtcagccattgtcgatgct
ttgcgagcctcgctcgatggcgagggcagggcgacaccggcctgcataggcactgtggaa
aagcttgtggcggaactcgccgaaggtgtgcggagcgcagcagcagcagcctga

DBGET integrated database retrieval system