KEGG   Beijerinckia indica: Bind_1990Help
Entry
Bind_1990         CDS       T00688                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bid  Beijerinckia indica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bind_1990
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bind_1990
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bind_1990
Enzymes [BR:bid01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bind_1990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2274131..2275375)
Genome map
AA seq 414 aa AA seqDB search
MPHEPLNSYRSGPDERGHFGIFGGRFVAETLMPLILDLEKHYALARVDPAFKAELDGLLT
HYVGRPSPLYYAERLTEHVRAIAAHAGGRGGAKVYFKREELNHTGAHKINNVLGQILLAR
RMGKTRIIAETGAGQHGVATATACARFGLECVIYMGAVDVERQKPNVFRMNLLGAKVVPV
QSGARTLKDAMNEALRDWVTNVTDTFYCIGTAAGPHPYPAMVRDFQCVIGEETRTQMLER
EGRLPDSLFACIGGGSNAIGLFHPFLDEPNVEIYGVEAAGFGLDKQHAASLAGGRPGVLH
GNRTYLLMDADGQIEEGHSISAGLDYPGIGPEHAWLKETGRVTYLSARDDEALDAFQLCA
KLEGIIPALEPAHALAKVVEVAPSKPRDHLLVVNISGRGDKDIFTVADYLAPVG
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgccccacgaacctctcaattcctatcgctcgggcccggatgagagagggcatttcggc
atttttggtggtcgattcgtcgccgaaaccttgatgccgctgattctcgatctcgaaaag
cattatgcgctggcacgcgtcgatcccgccttcaaggcggagctcgatggtcttctgacg
cattatgtcggcaggccgagccctctttattacgctgagcgtttgaccgaacatgtgcgt
gctattgcggcgcacgccggtggcaggggaggcgccaaggtctatttcaagcgcgaggag
ctgaaccatacgggcgcgcataagatcaataatgtgctcggccagattctcttggcgcgg
cggatgggcaagacgcgcatcatcgccgagacgggggccggccagcatggcgtagcgacc
gccacggcctgcgcgcgcttcggcctcgaatgcgtgatctatatgggcgcggtcgacgtc
gaacggcaaaagcccaatgtctttcgcatgaaccttttgggtgccaaggttgtgcccgtg
caatcgggagcacgaaccctgaaggatgcgatgaacgaggccttgcgtgactgggtgacc
aatgtcaccgatacattctattgcattggcacggcggcgggtccgcatccttatccagcc
atggtgcgtgatttccaatgcgtgatcggcgaggaaactcgcacgcaaatgctggaacgc
gaggggcggcttcccgactcgctttttgcctgcattggcggcggttccaatgcaatcggc
ctgtttcatccctttctcgacgagccgaatgtggagatttacggggtcgaggcggcgggt
ttcggcctcgacaagcaacatgccgcctcgctagcgggtggacggcctggcgtcttgcac
ggtaatcggacttatcttctcatggacgcggatggtcagatcgaagaaggccactcgatc
tcggcggggctggattatccggggatcggcccggaacacgcatggttgaaggagaccggc
cgcgtcacctatctctcggcccgagacgatgaggccttggacgcctttcagctttgcgca
aagctcgagggaatcatcccggcgctggagccggctcatgccttggcgaaggtggtcgaa
gtcgcgccctcaaagccgcgtgatcatcttttggtggtcaatatttcaggccgtggtgac
aaagacattttcacggtcgccgattatctggcgccagttggctag

DBGET integrated database retrieval system