KEGG   Beijerinckia indica: Bind_2204Help
Entry
Bind_2204         CDS       T00688                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
bid  Beijerinckia indica
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bind_2204
Enzymes [BR:bid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Bind_2204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2524033..2526420
Genome map
AA seq 795 aa AA seqDB search
MDDRAHGPAGISQPLSPDLLQRLNAWWRAANYLSVAQLYLLDNPLLRQKLTLDHIKPRLL
GHWGTTPGLNFIYVHLNRIIKERDLDILFIAGPGHGAPGLIANSWLEKTYSEVYPAVSQD
IEGMTRLCRQFSFPVGIPSHAAPETPGSIHEGGELGYSLSHAFGAVFDNPDLIAACVIGD
GEAETGPLATSWHANKFLDAARDGAVLPILHLNGYKIANPTVLGRIPSDELENLLQGYGY
APLFVEGDDPDIMHRHMAEALNVAFAGIAKIQRAARVEGHIERPRWPMLVLRSPKGWTGP
KTVDGLKTEGFWRAHQVPFTIADKPEHLSLLESWLKSYRPEELFEESGALKPEIASLAPS
GERRMSANPQANGGNLPRPLQIPDFTLHAVDVDYPGARTAEATFVMGQFLRDIMRANETN
KNFRVFGPDETASNRLQALYDVTDKTWNAAFIAEDEHLDPTGRVMEILSEHTCQGWLEGY
LLTGRHGLMSCYEAFIHIVDSMVNQHAKWLKTARGVPWRRPIASLNYLLTSHVWRQDHNG
FSHQDPGFIDHIANKKSDIARVYLPPDANCLLYITDHCLRSWNRINVIVAGKQPEPQWLD
MEEAISHCRAGLGIWSFASNDQDSEPDVVLACAGDVPTLETLAAADFLHTHLPEVKVRVV
NIVDLFALEPQTRHPHGWSDKDFDTLFTKDKPVIFAYHGYPSLIHRLIYKRTNHSNFHVH
GYQEEGSTTTPFDMVVRNRLDRFHLVGDVVDHLPKLGAKAAYVKQWLRDKFAEHERYIVA
HGEDLPEIRHWRWPE
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcgcgcgcacggtccggccggaatcagtcagcctctctcgccggatctgttg
cagcgtctcaatgcctggtggcgcgccgccaattatctctcggtggcgcagctctacctt
ctcgacaatccgctgttgcggcaaaagctcaccctggatcatatcaagccgcgcctgctc
ggccattggggcacgacaccggggctcaatttcatctatgtgcatctcaacaggatcatc
aaggaacgcgatctcgatattctgttcattgctggccccgggcatggcgcgccggggctc
attgccaatagctggctggaaaagacctatagcgaggtctatcccgctgtttcgcaagat
atcgaaggcatgacccggctatgccgccaattttcattccctgtcggcatcccgagccat
gcggcgccggaaacacccggctccatccatgaaggcggcgagcttggctattcgctctcc
catgcctttggcgcggtctttgacaaccccgacctgatcgcggcctgcgtgatcggagac
ggcgaggcggaaaccggcccactcgccacgtcatggcatgccaataaatttctcgatgcc
gcgcgtgatggcgccgtgctgccgatccttcatctcaacggctataaaatcgccaatccc
accgtgctcgggcgcatcccgtccgatgaattggaaaatctgctgcaaggctatggctat
gcgccccttttcgtcgaaggcgacgacccggacattatgcatcggcacatggccgaagca
ctaaatgtcgcttttgcgggtattgccaaaatccagcgagccgcacgtgtcgagggccat
atcgagcggccacgctggcccatgctggtgctccgcagccccaagggctggaccggcccc
aaaacggttgacgggttgaagacggaaggattttggcgtgcccatcaggtcccattcacc
atcgccgacaagcctgaacatctctcgcttctcgaaagctggctgaaaagctaccgaccg
gaggagcttttcgaggaaagcggcgccctcaagccggagattgcttccctggcccccagc
ggggagcgccgaatgagcgccaatccgcaggccaatggcggcaacttgccacggccgttg
caaataccggattttaccctgcatgccgtcgatgtcgattaccccggcgcacgaacggca
gaggcgactttcgttatggggcaatttctgcgcgacatcatgcgcgccaatgagacaaac
aagaatttccgcgtcttcgggccggatgaaaccgcctccaaccgtttgcaggcgctctac
gacgtcacggacaagacctggaatgccgccttcatcgcggaggatgaacatctcgacccg
acgggccgcgtcatggaaatcctcagcgaacatacatgccaaggctggcttgaaggctat
ctgctcacggggcgccatggcctcatgtcttgttatgaggccttcattcatattgttgat
tccatggtcaatcagcacgccaaatggctcaagacggcgcgtggtgtcccatggcgtcgg
cccatcgcctcgctcaattatcttctaacgtctcatgtctggcgccaggatcataatggc
tttagccatcaggatcccggtttcatcgatcatatcgccaacaagaaatccgatatcgcg
cgcgtttatctaccgccggatgccaattgccttctctatatcaccgatcattgtctgcgc
agctggaacaggatcaatgtcattgtcgccggcaaacagccggaaccgcaatggctcgac
atggaggaagcgatcagccattgccgcgccggtctcggcatctggagtttcgctagcaat
gatcaagatagcgagcccgatgtggtcctcgcctgcgccggcgacgtgccaacgctcgaa
accctcgccgcagccgatttcttgcatacacatctgccggaggtgaaagtccgtgtcgtc
aatatcgttgatctgtttgcgctagagccgcaaacacgccatccgcatggctggagcgat
aaggattttgatacgctgttcaccaaggacaaaccggtgatcttcgcctatcatggttat
ccttccctcatccatcggctgatctacaagcggaccaaccattccaatttccacgtccac
ggctatcaggaagagggttcaacgacgacacccttcgatatggtggtgcgcaaccggctc
gatcgttttcatctcgtcggcgacgttgtcgatcatctaccgaagctcggcgccaaggcg
gcctatgtcaaacaatggctgcgtgacaagttcgccgagcacgaacgctatatcgtggcg
catggcgaggatttgccggagatccgtcattggcgctggccagaatga

DBGET integrated database retrieval system