KEGG   Beijerinckia indica: Bind_2290Help
Entry
Bind_2290         CDS       T00688                                 

Definition
glycoside hydrolase family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bid  Beijerinckia indica
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bind_2290
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Bind_2290
Enzymes [BR:bid01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bind_2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2620834..2622123)
Genome map
AA seq 429 aa AA seqDB search
MTRFIHKPLSILAGVWVTFAAILFWLALLISDLIVFPYRFIACAILFTVGLVACIIFVLV
GRRWIAALFAVVGMLAVWQAARPWIDRHYVLANREPETVDVERHFVVGYDNIATIRELVR
DAHIGGIFLTRRNVEGRTLTEVAAEIDGLQSIRREAGLPGLIVAADQEGGPVSHLSPPLP
IPPALSSIAGLPLDKRFEAAEQLGVVQGSALREIGITMDLAPVCDLMPQSPPGIFDRHTR
IAARSISDDPTIAAVIASGFSKGLLAMGVTPTAKHFPGLGRVTADTHLFSASLNTAEEDL
LKTDWVPFRAVLDIPGAAVMLSHVSLDNVEFGVPASRSKRVITGILREQWGFRGVAISDD
LTMGAAQHAGLCRAVEGAFNAGIDLLLVSWDADKIYPALRCGLDALNAGRLDRAMLKQSA
QRLDQLKGR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacccgatttatccataaacctttatcaatattggcaggagtgtgggtcacttttgcc
gctattcttttttggctcgctctcctgattagcgatctgatcgtctttccttaccggttc
atcgcctgcgcgatactcttcaccgtgggattggtcgcgtgcatcatctttgttttggtg
ggacgtcgttggatagccgcattgtttgctgtcgttggcatgctcgcggtgtggcaagcc
gctagaccttggatcgatcggcattatgtgctcgccaacagggagccggaaaccgtcgat
gtcgaacgccactttgtcgttggatacgataacatcgcaaccatcagggagctggttcgt
gacgcccatatcggcggcattttcctgacgcgtcgtaatgtcgagggccggacacttaca
gaggttgcggctgaaatcgatggccttcagtcgattcggcgcgaggccggccttcctggc
ctcatcgttgcggccgatcaggagggcgggcccgtctcacatctctcaccgccattgcca
atcccgccagccctgtccagcatcgccggcctcccgttggacaagcgctttgaagctgcc
gagcaactcggcgtcgttcaaggttccgctctgcgagagatcggcatcacgatggatctt
gcgcccgtgtgcgatctcatgccccagagccctcccggcatcttcgatcggcacacccgt
atcgcggcacgatcgatctccgatgatccgaccatcgccgccgtgatcgccagcggcttc
tcaaagggccttcttgccatgggtgtgacgcccacggccaaacatttccctggcctcggg
cgcgtcacagctgacacccatcttttcagtgcctcgttgaatacggccgaggaggacctt
ctcaagactgattgggtcccgttccgcgcggttctcgatattcctggtgccgctgtcatg
ctgtcccatgtctcgcttgacaatgtcgagtttggcgtccccgcgtcacgctccaagcgc
gtcatcaccggcattctgcgtgagcaatgggggttccgtggagtcgccatcagcgatgat
ttgacaatgggtgcagcccaacatgccggcctatgccgagccgttgaaggggcgttcaac
gccgggatcgatcttttgctggtttcttgggatgcggataagatctatccagccttgcgc
tgcggtttggatgcgttgaatgcagggcggctcgaccgagccatgctgaagcaaagtgca
cagcggctggatcaacttaaaggcagatag

DBGET integrated database retrieval system