KEGG   Beijerinckia indica: Bind_2643Help
Entry
Bind_2643         CDS       T00688                                 

Definition
(GenBank) Endo-1,4-beta-xylanase
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bid  Beijerinckia indica
Brite
Enzymes [BR:bid01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Bind_2643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_10 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: ACB96224
JGI: Bind2643
UniProt: B2IJA6
Position
complement(3007211..3009523)
Genome map
AA seq 770 aa AA seqDB search
MRLLLFTSEFYPLRGGIGTYAAELARGATELGGDVTLYAPSYHQDLADDDLKCFPFRVIR
YAGHRHTMKNLPQKLQIVRRAVRSETFDIIHAMDWPFFLPVHLMAPSKVHKLFTVHGSDV
NEMRAPVKATIISLVRLFSGKSEILANSNFTRSLFNQHFPDIPPHKVKTEWLGVSDFWFQ
PAANRSETRFKLGVADDAYVILTVGRLTPRKGHLSVIEALSRLPERIKEHTIYIIVGPHY
DGEYTSKVKVAAAASGCKTLFLNELSDDVLRDLYKACDVFCLTGHTKLNGLVEGFGLVYL
EAGAQGLPSIAGNVGGMPEAVEHGKSGLVVNSNDADSIAQSLCELHDLPRFRQALADGAL
ERAKILTWRRCVAASYGFSSHHAKWLQPHSSPISLTSDITQPQNGLARRSVLGAFASVGL
LKTKILAATPTTILPLKQAAARVGLLFGCAFDKIAISDAAYGALIKTHAAILTTDYHMKF
KALRRNGPEADFTIADSLITFADAASIPIRGHNLIWNEGNPDWLIKLPANERIEWLERHI
KEVMGRYRGRIHSWDVVNEPFWPGHKKPGGFRDGPWYSALGPEYIIKAFQIARRTDPSAK
LVLNEAWVERSDDLGLVVREELFKLLQDLSVRGLIDAVGLECHIRPHYTRNFDILAQFIA
KVSTLGIDVYITELDVDDSIFSGSMSEIDDKVAEIYGDFVRAITKAPAVKILETWQLADR
YSFYQDQRKGTARPLPFDTSLAPKPAYHTIISALIDAGSQPVGVVRTPQH
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttttattatttacaagtgaattttatcctttacgcggtggaatcgggacatat
gcagccgaactcgcccgcggtgctacggagcttggtggtgacgtaacgttatacgcaccg
tcctatcaccaagacttagctgatgatgacttaaaatgctttcctttccgtgttatccgc
tatgccgggcatcggcatacgatgaagaatcttccgcaaaaattgcagattgtgcgccgt
gcagttcgatccgagacatttgatattattcatgccatggattggcccttcttcctgcca
gtccacctcatggctccatcaaaagtgcacaaactgttcacagtacatggtagtgatgtc
aatgaaatgcgggcgccggttaaagcaactatcatatcgttagttcgactattctcgggt
aaatcggaaattttagcaaatagtaactttactcgttctctcttcaaccaacatttcccc
gacataccaccccataaagtaaaaacggagtggcttggagtatcggatttctggtttcaa
ccagctgctaatcgtagcgaaacgagattcaaactcggtgttgcagatgatgcttatgtc
attctcacggtaggacgcctcacgcccagaaaaggccatctctctgtaattgaagctcta
tcacgtcttccagagcgtattaaggaacacacgatttatataatcgtcggacctcactat
gatggtgagtacaccagtaaggtgaaggttgctgctgcggcgtctggatgcaaaacattg
tttttaaatgaactatcagacgacgtcttgcgtgatctttacaaggcgtgcgatgtgttt
tgcctcactggacacacaaagctaaacggtcttgtcgaaggtttcggacttgtctatttg
gaagctggcgcacaagggttaccgtcgatcgctggtaacgttggcggtatgccggaagct
gttgagcacggaaaatctggattggtcgtcaatagcaacgatgcagactctatcgcgcaa
tcattgtgtgaactccatgatcttccgagattccgccaagcattggcagatggagcgctt
gaacgagcgaagattttgacttggcgccgttgtgttgcagcttcgtatggtttttcatcc
catcatgcaaagtggctccaaccacattctagtccaatttctcttacatcagatatcacc
caaccgcagaatgggcttgcgcgccgtagtgtgcttggagccttcgcgtcagttggactt
cttaaaacgaaaatattagcggcaacgcccacaacgatccttcctttgaagcaggctgcc
gcacgcgtaggtcttttattcggatgtgctttcgataagatagcgatttctgatgcagcc
tatggagcgctcatcaagactcacgctgcaatccttacaaccgattaccatatgaaattt
aaggcacttcgtcgtaatggaccagaagcggatttcacgatcgcagatagtttaattacg
tttgcggatgcggcaagtatccctattcgtggccataatctgatttggaacgagggaaat
ccagattggttaatcaaacttcctgcaaatgaacgcattgagtggttagaacgccatatc
aaggaggtgatggggcgttatcgtggccgcatacattcttgggatgtagtcaatgagcct
ttttggcctggccataaaaagccaggcggctttcgggatggcccttggtattccgcactt
ggaccagaatatatcatcaaggcttttcaaatagctcgacgcaccgatccgtcagctaag
ctcgtcttaaatgaagcttgggtggaacggtctgatgatctcggcttagttgttcgcgag
gagttgtttaagcttctccaggatctttcggtgcgaggtcttattgatgcagttggtctt
gagtgtcatatccgcccccattatacgcgaaatttcgatatccttgcacaattcatcgca
aaggtgagtacgcttggaattgatgtctatatcaccgaactcgatgttgatgattctatt
ttctctggctcgatgtctgagatcgacgataaggtcgccgaaatctatggggatttcgtc
cgtgctatcacaaaagctccagccgtgaaaatcttagagacttggcaattggctgatcgc
tatagcttttatcaagatcagcgtaagggaacagcgcgtcctttaccatttgacacttca
cttgcacctaagccagcataccatacaattattagcgctcttatagacgccggctctcaa
cctgttggagtagtcaggacaccccaacactag

DBGET integrated database retrieval system