KEGG   Beijerinckia indica: Bind_2750Help
Entry
Bind_2750         CDS       T00688                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bid  Beijerinckia indica
Pathway
bid00020  Citrate cycle (TCA cycle)
bid00190  Oxidative phosphorylation
bid00650  Butanoate metabolism
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01120  Microbial metabolism in diverse environments
bid01130  Biosynthesis of antibiotics
bid01200  Carbon metabolism
Module
bid_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bid_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bid_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bind_2750
   00650 Butanoate metabolism
    Bind_2750
  Energy metabolism
   00190 Oxidative phosphorylation
    Bind_2750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACB96322
JGI: Bind2750
UniProt: B2IJU7
Position
complement(3135434..3135826)
Genome map
AA seq 130 aa AA seqDB search
MRHDSSSMRTAASRVRFLGAARSGTAETWHMRATSVALLPLSIAFVWIVLSLLGKNYQDV
VATLGSPLPALLILLFVLASVYHMKIGMQSIIDDYVHEPHFKDWALLGNLFFSFCIGLAC
IYAVLKLSFL
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaggcatgattcttcttccatgcggaccgcggcgagccgggttcgttttctcggcgcg
gcgcgatccggaaccgccgaaacttggcatatgcgggctacatcggttgccttgttgccc
ctgagcattgccttcgtctggatcgtcctttccttgctcggcaagaattatcaggacgtc
gtcgcgacgctcggtagccccttgcccgcgcttctcatcctgcttttcgtgctcgccagc
gtctatcatatgaagattggcatgcagtcgatcattgatgattacgttcacgaaccgcat
ttcaaggattgggcgcttctgggcaatctcttcttttccttctgcatcggcctcgcctgt
atctatgccgtcttgaagctgagcttcctctga

DBGET integrated database retrieval system