KEGG   Beijerinckia indica: Bind_2750Help
Entry
Bind_2750         CDS       T00688                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bid  Beijerinckia indica
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bind_2750
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bind_2750
   00650 Butanoate metabolism
    Bind_2750
  Energy metabolism
   00190 Oxidative phosphorylation
    Bind_2750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3135434..3135826)
Genome map
AA seq 130 aa AA seqDB search
MRHDSSSMRTAASRVRFLGAARSGTAETWHMRATSVALLPLSIAFVWIVLSLLGKNYQDV
VATLGSPLPALLILLFVLASVYHMKIGMQSIIDDYVHEPHFKDWALLGNLFFSFCIGLAC
IYAVLKLSFL
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaggcatgattcttcttccatgcggaccgcggcgagccgggttcgttttctcggcgcg
gcgcgatccggaaccgccgaaacttggcatatgcgggctacatcggttgccttgttgccc
ctgagcattgccttcgtctggatcgtcctttccttgctcggcaagaattatcaggacgtc
gtcgcgacgctcggtagccccttgcccgcgcttctcatcctgcttttcgtgctcgccagc
gtctatcatatgaagattggcatgcagtcgatcattgatgattacgttcacgaaccgcat
ttcaaggattgggcgcttctgggcaatctcttcttttccttctgcatcggcctcgcctgt
atctatgccgtcttgaagctgagcttcctctga

DBGET integrated database retrieval system