KEGG   Beijerinckia indica: Bind_3152Help
Entry
Bind_3152         CDS       T00688                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bid  Beijerinckia indica
Brite
Enzymes [BR:bid01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Bind_3152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3596406..3597428
Genome map
AA seq 340 aa AA seqDB search
MKGKDVLVTGGSGFVGSAVSRALIEAGFSVRVLTRGTSPRGNLSGLDVEIVEGDMRDPDA
VARAMAGVQFLFHVAADYRLWARDPREIHLNNVEGTRIVMQNAQKAKVERVIYTSSVATL
AFQPNGSVTDETMPLCEAQAIGAYKRSKIAAERMVTRMIREEGLPAIIVHPSTPIGPRDI
KPTPTGRIIVEAARGNIPGFVDTGLNLVHVDDVASGHLAALRRGEIGGHYILGGQNVAFS
NLLAEIARLGGHKTPKFRIPRPLVYPFAYAAEARARLNGRTPFLTLDGLRMSKHHMFVSS
AKAERELGYHARPYQDALIEAFAWFRDQGYLGLSGMEKFS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggcaaggatgttctggtcaccgggggatcaggtttcgtcgggtcggcggtgagt
cgcgccctgatcgaagccggatttagcgttcgtgtcctgacgcgcggaaccagcccgcgg
ggcaatctttcgggcctcgatgtcgagattgtcgagggcgacatgcgcgatccggacgcc
gtggcccgcgccatggccggcgtccagttcctgttccatgtcgccgccgattatcggctc
tgggcacgcgatccgcgggaaatccacctcaacaatgtcgagggcacccgcattgtcatg
caaaatgcgcaaaaggccaaggttgagcgcgtcatctatacgagttccgtggcgaccttg
gctttccagcccaatggttcggtgaccgacgagacaatgcccctgtgcgaggcgcaggcg
atcggcgcctataagcgcagcaagatcgccgccgagcgaatggtcacacggatgatccgt
gaggaggggctgccagcgatcatcgtgcatccctccaccccgattggcccccgcgacatc
aagccgacgccgaccgggcgcatcatcgtcgaggcggcacgcggcaacattccagggttc
gtggacaccggcctcaatctggttcacgtggacgatgtcgcaagcggccatctcgccgcc
ttacggcgcggcgaaatcggtggccattatattctcggcggccagaatgtcgctttttcc
aatctgcttgcggaaatcgcccggctcggcggccataaaacgccgaaatttcgcattccg
cgtcccctggtctatcccttcgcctatgccgccgaggccagggcgcgcctaaatggacgc
acgcccttcctgaccctggacggcttgcgcatgtccaaacatcatatgttcgtcagttcg
gcgaaggcggaacgtgaacttggctatcatgcccgcccctatcaggacgccttgatcgag
gccttcgcctggtttcgcgaccagggctacctcgggctttccggaatggagaagttttca
tga

DBGET integrated database retrieval system