KEGG   Beijerinckia indica: Bind_3205Help
Entry
Bind_3205         CDS       T00688                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
bid  Beijerinckia indica
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Bind_3205
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bind_3205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3646848..3647279)
Genome map
AA seq 143 aa AA seqDB search
MVSAGFIFRPILQAARRADVRVLALLCALAGSALGAKAEDAEKGKQQFLTSCGVCHTAEP
GAGNRQGPNLAGVYGRKVGSIADFNYSPALKSGTWVWNETTLDPWLTNSQEAHPGTFMNY
RQANAEKRRLVIDYLSSLSKESK
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggtttccgcgggttttatctttcgtccaattttacaggcagcgcggcgcgccgatgtc
cgtgttcttgcgcttttgtgcgcgctagcggggtcggctcttggggcgaaggccgaggat
gccgaaaagggaaaacaacagtttttgaccagttgcggcgtctgccatacggccgaaccc
ggagccggcaatcgccaggggcccaatcttgctggcgtctacggccgcaaggtcgggagc
atcgccgattttaactattcgccggcgttgaaatccggcacctgggtatggaatgagacg
acactcgatccctggttgaccaattcgcaggaagcgcatccgggaaccttcatgaattac
cggcaggccaatgcggagaagcggcgtctggtgatcgattatctgagttcattgtccaag
gagagcaaataa

DBGET integrated database retrieval system