KEGG   Beijerinckia indica: Bind_3205Help
Entry
Bind_3205         CDS       T00688                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
bid  Beijerinckia indica
Pathway
bid01100  Metabolic pathways
bid01120  Microbial metabolism in diverse environments
bid02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bid00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bind_3205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACB96765
JGI: Bind3205
UniProt: B2ID00
Position
complement(3646848..3647279)
Genome map
AA seq 143 aa AA seqDB search
MVSAGFIFRPILQAARRADVRVLALLCALAGSALGAKAEDAEKGKQQFLTSCGVCHTAEP
GAGNRQGPNLAGVYGRKVGSIADFNYSPALKSGTWVWNETTLDPWLTNSQEAHPGTFMNY
RQANAEKRRLVIDYLSSLSKESK
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggtttccgcgggttttatctttcgtccaattttacaggcagcgcggcgcgccgatgtc
cgtgttcttgcgcttttgtgcgcgctagcggggtcggctcttggggcgaaggccgaggat
gccgaaaagggaaaacaacagtttttgaccagttgcggcgtctgccatacggccgaaccc
ggagccggcaatcgccaggggcccaatcttgctggcgtctacggccgcaaggtcgggagc
atcgccgattttaactattcgccggcgttgaaatccggcacctgggtatggaatgagacg
acactcgatccctggttgaccaattcgcaggaagcgcatccgggaaccttcatgaattac
cggcaggccaatgcggagaagcggcgtctggtgatcgattatctgagttcattgtccaag
gagagcaaataa

DBGET integrated database retrieval system