KEGG   Beijerinckia indica: Bind_3293Help
Entry
Bind_3293         CDS       T00688                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bid  Beijerinckia indica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bind_3293
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bind_3293
   00052 Galactose metabolism
    Bind_3293
   00500 Starch and sucrose metabolism
    Bind_3293
   00520 Amino sugar and nucleotide sugar metabolism
    Bind_3293
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bind_3293
   00524 Butirosin and neomycin biosynthesis
    Bind_3293
Enzymes [BR:bid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bind_3293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3745371..3746333)
Genome map
AA seq 320 aa AA seqDB search
MEIVAVDIGGTHARFALAEVADGRVVHLGEAVTLQAAEHGSFQLAWETFAQIAGRALPRA
VAIAIACPVGGEVLKLTNNPWIIRPALIPEKLHVDAWTLVNDFGAIAHTVAQVGEDQLMP
ITGPDHALPQDGVISIVGPGTGLGVGHVLRRGGHYHVIECEGGHIDFAPLDSLEDQILKY
MRHRYPRVSVERLISGPGLVNIYEALAAIEGKSLDPIGDKELWAAAMAGKDSLAAAALDR
FCLSLGAVCGDIALALGAKSVVIAGGLGLRIASLLPQSGFATRFTAKGRFAPMMATIPVR
CIIHPQPGLYGAAAAFAVEH
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttggagatcgtggcggtcgatatcggggggacgcatgcccgtttcgccttggccgaagtg
gctgatggccgggtggtgcatctcggtgaggctgtcacgttgcaagctgcggagcatggg
agtttccagctcgcctgggagactttcgcgcaaatcgctggccgcgccttgccgcgcgcc
gtggccattgccatagcctgtcccgtcggcggcgaagttctgaaactcaccaataatccc
tggattatccgtccggctttgatccccgaaaagcttcatgtcgatgcctggacgctcgtc
aatgatttcggggcgattgcccatactgtcgcgcaagtcggtgaagatcagctcatgccg
attaccggccctgatcacgctttgccgcaagacggtgtcatcagtatcgtcggccccggg
acggggcttggcgtgggacacgtgctgcgccgcggcggacattatcatgtcattgaatgc
gagggtggccatattgatttcgcacccctcgatagcctggaagatcagatcctcaaatat
atgcggcatcgctacccccgtgtttcggtcgagcgactgatttcgggacctgggctcgtc
aatatttatgaagcgctggccgcgatcgaaggaaaatcgctcgacccgatcggcgacaag
gaattatgggcagcggccatggcgggcaaggatagtcttgcagcggcggcgctcgaccgc
ttttgtctgagccttggtgcggtctgtggtgatatcgctttggctttgggggctaaatcg
gtggtcatcgccggcgggctcggcctgcgcattgcctccttgctcccgcaatcgggcttt
gccacgcgcttcaccgccaaggggcggtttgcgccaatgatggcgacgattcccgtgcgg
tgcatcatccatccgcagccaggactttatggagccgcggccgccttcgccgtggaacat
tga

DBGET integrated database retrieval system