KEGG   Beijerinckia indica: Bind_3293Help
Entry
Bind_3293         CDS       T00688                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bid  Beijerinckia indica
Pathway
bid00010  Glycolysis / Gluconeogenesis
bid00052  Galactose metabolism
bid00500  Starch and sucrose metabolism
bid00520  Amino sugar and nucleotide sugar metabolism
bid00521  Streptomycin biosynthesis
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01120  Microbial metabolism in diverse environments
bid01130  Biosynthesis of antibiotics
bid01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bind_3293
   00052 Galactose metabolism
    Bind_3293
   00500 Starch and sucrose metabolism
    Bind_3293
   00520 Amino sugar and nucleotide sugar metabolism
    Bind_3293
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bind_3293
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Bind_3293
Enzymes [BR:bid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bind_3293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ACB96852
JGI: Bind3293
UniProt: B2IDS0
Position
complement(3745371..3746333)
Genome map
AA seq 320 aa AA seqDB search
MEIVAVDIGGTHARFALAEVADGRVVHLGEAVTLQAAEHGSFQLAWETFAQIAGRALPRA
VAIAIACPVGGEVLKLTNNPWIIRPALIPEKLHVDAWTLVNDFGAIAHTVAQVGEDQLMP
ITGPDHALPQDGVISIVGPGTGLGVGHVLRRGGHYHVIECEGGHIDFAPLDSLEDQILKY
MRHRYPRVSVERLISGPGLVNIYEALAAIEGKSLDPIGDKELWAAAMAGKDSLAAAALDR
FCLSLGAVCGDIALALGAKSVVIAGGLGLRIASLLPQSGFATRFTAKGRFAPMMATIPVR
CIIHPQPGLYGAAAAFAVEH
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttggagatcgtggcggtcgatatcggggggacgcatgcccgtttcgccttggccgaagtg
gctgatggccgggtggtgcatctcggtgaggctgtcacgttgcaagctgcggagcatggg
agtttccagctcgcctgggagactttcgcgcaaatcgctggccgcgccttgccgcgcgcc
gtggccattgccatagcctgtcccgtcggcggcgaagttctgaaactcaccaataatccc
tggattatccgtccggctttgatccccgaaaagcttcatgtcgatgcctggacgctcgtc
aatgatttcggggcgattgcccatactgtcgcgcaagtcggtgaagatcagctcatgccg
attaccggccctgatcacgctttgccgcaagacggtgtcatcagtatcgtcggccccggg
acggggcttggcgtgggacacgtgctgcgccgcggcggacattatcatgtcattgaatgc
gagggtggccatattgatttcgcacccctcgatagcctggaagatcagatcctcaaatat
atgcggcatcgctacccccgtgtttcggtcgagcgactgatttcgggacctgggctcgtc
aatatttatgaagcgctggccgcgatcgaaggaaaatcgctcgacccgatcggcgacaag
gaattatgggcagcggccatggcgggcaaggatagtcttgcagcggcggcgctcgaccgc
ttttgtctgagccttggtgcggtctgtggtgatatcgctttggctttgggggctaaatcg
gtggtcatcgccggcgggctcggcctgcgcattgcctccttgctcccgcaatcgggcttt
gccacgcgcttcaccgccaaggggcggtttgcgccaatgatggcgacgattcccgtgcgg
tgcatcatccatccgcagccaggactttatggagccgcggccgccttcgccgtggaacat
tga

DBGET integrated database retrieval system