KEGG   Beijerinckia indica: Bind_3336Help
Entry
Bind_3336         CDS       T00688                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bid  Beijerinckia indica
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bid01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bid00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3792358..3793509
Genome map
AA seq 383 aa AA seqDB search
MSETALDLARALISCPSVTPQDGGTLGVLESRLKASGFRTHRLTFHEEGTPDIDNLYARF
GSGAPCLVFAGHTDVVPVGTATDWRFDPFAAKVEDGQLWGRGAADMKGAIAAFTAAALTF
IEQHKDFKGSIAFLITGDEEGPSINGTIKLLKWAAEQGEHFDHCIVGEPTNPQVLGDMIK
IGRRGSLNGILSITGKQGHVAYPHRADNPVPKLMRLIEALIGTPLDEGTDHFDASNLEVV
ALSSGTDAYNVIPAKAEARFNIRFNDLWTPQTLELELLARLDSVAEGTAYTLTFEPCNAL
AFITKPDQFTDLVANAIEKQTGRRPELSTTGGTSDARFISAYCPVVEFGLVGQTMHMVDE
RVSVADIATLETIYTSILEGYFP
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaaccgcgctcgatctcgcccgcgccctcatttcctgtccttccgtcacaccg
caggacggcggcacgctcggtgtcctcgaaagccggttgaaggcatcgggctttcgcacc
catcgcctaaccttccacgaagaaggcacgcccgatatcgacaatctctatgcccgtttc
ggctcaggcgcgccttgtctcgttttcgccggccacacggatgtcgtgcctgtcggcaca
gccacggattggcggttcgatcccttcgcggccaaggtcgaggatggccagctttgggga
cgcggcgccgccgatatgaagggtgccatcgccgcattcacggcggcggctcttaccttt
atcgaacagcacaaggattttaagggctcgatcgccttcctcatcaccggtgatgaagaa
ggcccctcgatcaatggcacgatcaagcttctgaaatgggcggccgaacagggcgaacac
ttcgatcattgtatcgttggcgagccgaccaatccgcaagtactcggcgacatgatcaag
atcggccggcggggttcgctgaatggcattttgagcatcaccggcaaacagggccatgtc
gcctatccgcatcgcgccgataatcctgttcccaaactgatgcgcctcattgaggcactg
atcggcacgccccttgatgaaggcacagatcatttcgacgcctccaatcttgaagtggtc
gcgctctcgtcaggaaccgacgcctataatgtcattccggcgaaagcggaggcgcgtttc
aacattcgtttcaatgatctgtggacaccgcagacattggagctcgagctgctcgcacgg
ctcgacagcgtggcagaaggaaccgcatacacactcactttcgagccctgtaacgcgctc
gccttcattacaaagccagatcaatttacagatctcgtcgcaaacgcgatcgagaaacag
accggccgtcgcccggaactttccacgaccggcggcacatcggacgcgcggtttatttcc
gcctattgcccagtcgtcgaattcgggctcgtggggcagaccatgcacatggtcgatgaa
cgagtgtccgtggctgacattgctacattggaaactatatacacttctattttagaaggt
tatttcccgtaa

DBGET integrated database retrieval system