KEGG   Beijerinckia indica: Bind_3336Help
Entry
Bind_3336         CDS       T00688                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bid  Beijerinckia indica
Pathway
bid00300  Lysine biosynthesis
bid01100  Metabolic pathways
bid01120  Microbial metabolism in diverse environments
bid01230  Biosynthesis of amino acids
Module
bid_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Bind_3336
Enzymes [BR:bid01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Bind_3336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACB96895
JGI: Bind3336
UniProt: B2IDW3
Position
3792358..3793509
Genome map
AA seq 383 aa AA seqDB search
MSETALDLARALISCPSVTPQDGGTLGVLESRLKASGFRTHRLTFHEEGTPDIDNLYARF
GSGAPCLVFAGHTDVVPVGTATDWRFDPFAAKVEDGQLWGRGAADMKGAIAAFTAAALTF
IEQHKDFKGSIAFLITGDEEGPSINGTIKLLKWAAEQGEHFDHCIVGEPTNPQVLGDMIK
IGRRGSLNGILSITGKQGHVAYPHRADNPVPKLMRLIEALIGTPLDEGTDHFDASNLEVV
ALSSGTDAYNVIPAKAEARFNIRFNDLWTPQTLELELLARLDSVAEGTAYTLTFEPCNAL
AFITKPDQFTDLVANAIEKQTGRRPELSTTGGTSDARFISAYCPVVEFGLVGQTMHMVDE
RVSVADIATLETIYTSILEGYFP
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaaccgcgctcgatctcgcccgcgccctcatttcctgtccttccgtcacaccg
caggacggcggcacgctcggtgtcctcgaaagccggttgaaggcatcgggctttcgcacc
catcgcctaaccttccacgaagaaggcacgcccgatatcgacaatctctatgcccgtttc
ggctcaggcgcgccttgtctcgttttcgccggccacacggatgtcgtgcctgtcggcaca
gccacggattggcggttcgatcccttcgcggccaaggtcgaggatggccagctttgggga
cgcggcgccgccgatatgaagggtgccatcgccgcattcacggcggcggctcttaccttt
atcgaacagcacaaggattttaagggctcgatcgccttcctcatcaccggtgatgaagaa
ggcccctcgatcaatggcacgatcaagcttctgaaatgggcggccgaacagggcgaacac
ttcgatcattgtatcgttggcgagccgaccaatccgcaagtactcggcgacatgatcaag
atcggccggcggggttcgctgaatggcattttgagcatcaccggcaaacagggccatgtc
gcctatccgcatcgcgccgataatcctgttcccaaactgatgcgcctcattgaggcactg
atcggcacgccccttgatgaaggcacagatcatttcgacgcctccaatcttgaagtggtc
gcgctctcgtcaggaaccgacgcctataatgtcattccggcgaaagcggaggcgcgtttc
aacattcgtttcaatgatctgtggacaccgcagacattggagctcgagctgctcgcacgg
ctcgacagcgtggcagaaggaaccgcatacacactcactttcgagccctgtaacgcgctc
gccttcattacaaagccagatcaatttacagatctcgtcgcaaacgcgatcgagaaacag
accggccgtcgcccggaactttccacgaccggcggcacatcggacgcgcggtttatttcc
gcctattgcccagtcgtcgaattcgggctcgtggggcagaccatgcacatggtcgatgaa
cgagtgtccgtggctgacattgctacattggaaactatatacacttctattttagaaggt
tatttcccgtaa

DBGET integrated database retrieval system