KEGG   Beijerinckia indica: Bind_3357Help
Entry
Bind_3357         CDS       T00688                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
bid  Beijerinckia indica
Pathway
bid02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bid00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bind_3357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Keratin_assoc
Motif
Other DBs
NCBI-ProteinID: ACB96914
JGI: Bind3357
UniProt: B2IDY2
Position
3809588..3810127
Genome map
AA seq 179 aa AA seqDB search
MSSFEFNKLSGGFFGALLFAMVLVTISNFIFAHPPLAKPGYDLPAAAEGGESGGGAEAAV
APLPERLAKADVKKGEADTKPCQACHTFEKGGAAKVGPPLWGIVDRAKGSIAGFSYSDAL
KAKGGEWTYDDLDAFITSPKSFVSGTKMAFGGEKDPQKRADLIDYLHTLSDEPKPLPTK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccttcgagttcaataagttgtctggcggtttttttggcgccctgctcttcgct
atggtgctcgtcaccatttccaattttatttttgcgcatccgccactggccaagcccggc
tatgatctgccagcggccgccgagggcggcgaatcgggtggtggtgccgaggctgccgtc
gcgccgctgccggagcgcttggccaaggccgatgtcaagaagggcgaagctgataccaag
ccctgccaggcctgccatacgttcgaaaagggtggcgccgccaaagtgggcccgcctctt
tggggcattgttgaccgtgccaagggttccatcgcgggcttctcttattcggatgctctg
aaggccaagggtggcgaatggacctatgacgacctcgatgccttcatcacctcgccgaaa
agcttcgtgagcggcaccaaaatggccttcggcggtgagaaagatccgcaaaagcgcgcg
gacctcatcgattatctgcatacgctctcggatgagccgaagcccctgccgacaaagtaa

DBGET integrated database retrieval system