KEGG   Beijerinckia indica: Bind_3431Help
Entry
Bind_3431         CDS       T00688                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
bid  Beijerinckia indica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bid00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3894887..3897034)
Genome map
AA seq 715 aa AA seqDB search
MKLKCFAAALAVASATLSTAHAQSIAPGAPGYKQGWSPANKQGFGTSTTHESNVWFTLGG
SGLTDVYFPRIDTPSIRDLQFVVSDGRTFAERESEATRYHVELAAPHSLVYRQINTANNK
RYRLTKTYSTDPERAVLLVDVTFESLDGHPYQLYALLNPAPGNDQMHTHGETFHHALVAS
NGNVASAFTADPPFTRTSNGYLGVSDGWQDLSSHHHMEWTYVVADQGNVVQTGQTTLDGV
TRKHLTIAIGFGSTTTQAASQAQDALRTGFDRIAQAYAYGWRRYLASLKPTPASAHDQKE
LYETSLMVLAAVEDKTYKGAFVASPTMPWAFGDGLDNPSDAYHLVWSRDLYQIASALLAA
GDRGAAERALAYLFDHQQKPDGSFPQNSLVDGTPIWGGLQMDEVAFPILLAWQLGRFDGA
TYTGHVKKAADFIIGHGPVSQAERWENQGGYSPATIAAEIAGLICAADIARRNGDEASAR
TYESTADTWKGKIETWTTTQTGPFSKSPYYLRLTKDGQGNSGTTYNIGDSGPDGVDQRAV
VDPSFLELVRLGIKAADDPIILNTLPVVDTQLGTTTPTGTFWHRYNFDGYGEKRDGSEWN
IGFPAGSQATIGRLWPIFAGERGEYDLLAKNPDSARARLKAMAATANDGLLIPEQVWDLN
PPSGQPDFLPGHPTTSATPLAWSHAQFVRLAWSIDHGYPLEQPAIVACRYAHQCK
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattgaaatgttttgctgcggcccttgccgtagcttcggccaccctttccacggct
catgcgcaaagcatcgcgcctggcgcgccgggctataagcagggttggagccccgccaac
aaacagggcttcggcacctccactacccatgagagcaatgtttggttcacactcggcggc
agcgggctgacggatgtttattttccgagaatagatacgccaagcatccgcgatttgcag
ttcgtcgtctcggacggccggacgttcgccgagcgcgagagcgaagccacgcggtaccac
gtggaattggccgctcctcacagccttgtctatagacagatcaataccgccaataacaaa
cgctatcggctcaccaagacttattcaacggatccagagcgcgccgtccttctcgttgat
gtaaccttcgagtcgctggatggccatccttatcaactctatgcactgctcaatccagct
cccggcaatgaccagatgcacacgcatggcgagacattccatcatgctctcgtggccagc
aatggcaatgttgccagtgccttcacggccgatccgcccttcacccgtacatcgaacggc
tatcttggcgtgagtgatggctggcaggacctgagcagccatcaccatatggagtggacc
tatgtggtcgccgatcaaggcaatgtcgtgcagaccggacagacaacgctcgacggtgtg
acacgcaagcatttgacgattgccattggctttgggagcacaacgacgcaagcggcaagc
caggcgcaagatgcgttgcgcaccggcttcgaccgcatcgcccaggcttatgcctatggc
tggcgccgctatcttgcttcgctgaaaccgacaccggcaagcgcccacgaccagaaagaa
ctttatgaaacgtcactgatggtcttggccgccgttgaggacaagacctacaaaggagcg
tttgtcgcctctcccaccatgccatgggcgttcggcgacgggctcgataatccatcggat
gcctaccacctcgtctggtccagggatctctatcagatcgcttccgcgctgctcgcggcg
ggcgaccgcggtgcggccgagcgggcgcttgcctacctcttcgatcaccagcaaaagccc
gatggttcattcccgcagaattcgctcgtggacggcacccccatttggggtggcctgcaa
atggacgaagtcgcatttcccattctgctggcatggcaattgggccgcttcgacggagcg
acctatacaggccatgtcaagaaagccgccgacttcatcattgggcatggacctgtcagt
caagcagagcgttgggaaaaccaaggcggttattcgcccgcgacaattgccgccgagatt
gccggtttgatctgcgcggccgatatcgcgcgccgcaatggcgatgaggcctcggctcgc
acttatgaatccaccgccgatacatggaaaggtaaaatcgagacttggacaaccacgcag
acaggtccgttttccaaatcgccttattacctgcgcctgaccaaggatggccaagggaac
tcagggaccacctacaatatcggtgacagcggtccagatggtgtcgatcagcgcgcagtt
gtcgatccaagctttctcgaactggtgcggctcggcatcaaggccgcggatgaccccatt
atcttgaatacgctgcctgtcgtcgatacacagctcgggaccacgacacccacggggaca
ttctggcatcgctataatttcgacggttatggagaaaaacgcgatggcagcgaatggaac
atcggtttccccgccggcagccaagcaacgatcggtaggctgtggcctattttcgcgggt
gagcgcggcgaatacgacttgctggccaagaatcccgactcagcccgtgcgcgcctgaag
gcgatggcggcgaccgcgaatgacgggctgctcattcctgaacaagtctgggacctcaat
cccccgtccggccaaccggatttccttcccggtcaccccaccacttccgccactccatta
gcatggtcgcatgcccaattcgtcaggctcgcctggtctatcgaccacggctatcccctg
gagcagcccgcgatcgtggcgtgccgctacgcgcatcaatgtaaatag

DBGET integrated database retrieval system