KEGG   Beijerinckia indica: Bind_3605Help
Entry
Bind_3605         CDS       T00688                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bid  Beijerinckia indica
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bind_3605
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bind_3605
   00640 Propanoate metabolism
    Bind_3605
   00660 C5-Branched dibasic acid metabolism
    Bind_3605
Enzymes [BR:bid01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bind_3605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4085657..4086889
Genome map
AA seq 410 aa AA seqDB search
MASANLISACMNIHEYQAKAILRDFGAPVSHGAPVLTPGEAEAAARALPGPVYVIKAQIH
AGGRGKGHFKEPEAGEKGGVRLARSLAEVKQAAEAMFDRTLVTVQTGPAGRKVQRLYIED
GCDIAREFYLSLLVDRSTSRISFVVSTEGGMDIEEVAHKTPDKIVSFSIDPVTGIEPHHG
RAAAVALGLGGDQAAQITQITTSLYKAFVAKDMAMLEVNPLVLTKEGRLLCLDAKVSFDP
NALYKHPDIVALRDENEEDPKEIEASKFDLAYIALDGTIGCMVNGAGLAMATMDIIKLYG
GNPANFLDVGGGASKEKVIHAFKIITADPQVKGILVNIFGGIMKCDVIAEGIIGAVKEVG
LKVPLVVRLEGTNVDLGKVLLERSGLDVIPADDLDDAAQKIVAAVGKGTV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggccaacctcataagtgcctgcatgaacattcacgaatatcaggccaaagca
attttgcgggatttcggggcgccggtttcgcatggagccccggtgttgacgcccggtgag
gcggaagccgcggcccgtgccctgccgggacccgtctatgtcatcaaggcacagattcac
gccggtgggcgtggcaaggggcatttcaaggaacccgaagctggcgagaaaggcggcgtg
cgtttggcgcgcagccttgccgaagtcaagcaggcagccgaagccatgtttgatcgcacg
ctcgtcacggttcagaccgggcctgctggacgcaaggtccagcgcctctatatcgaggat
ggctgcgacattgcccgtgagttctatctgtctctgcttgttgatcgctccacgagcaga
atttctttcgtggtgtccacggaaggtggcatggacatcgaggaggtcgcccataaaact
cccgacaagatcgtgagtttttcgatcgatcccgtgactggcatcgagccacaccatggc
cgcgctgccgctgtggctttgggccttggcggtgatcaggcggcgcaaatcacgcagatc
accacctctctctacaaagccttcgtcgccaaggacatggcgatgctcgaggtcaatccg
ctggtgctgaccaaggaggggcgccttctttgtctcgacgcgaaggtctccttcgatccg
aacgcactctacaaacatccagatattgtcgcgctgcgtgatgaaaacgaggaagatcct
aaggagatcgaggcctcgaaattcgatctcgcctatatcgccctcgatggcacgatcggc
tgcatggtgaacggcgcgggtctcgccatggcgacgatggatatcatcaagctctatggc
ggcaatccggcgaatttcctcgatgttggcggcggcgccagcaaggaaaaagtcattcac
gcgttcaagatcatcaccgccgatcctcaggtcaaagggattctcgtcaatatttttggc
ggcatcatgaaatgcgatgtcattgccgagggcattattggcgccgtcaaggaagtgggt
ctcaaagtgccgctcgtggtgcggcttgaagggaccaatgtcgacctcggcaaagtgctt
ttagagcgctccggtctcgatgtcataccagccgatgacctcgacgacgccgcgcagaag
atcgtcgcagcagtcggaaaaggaacagtctga

DBGET integrated database retrieval system