KEGG   Beijerinckia indica: Bind_3608Help
Entry
Bind_3608         CDS       T00688                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bid  Beijerinckia indica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bind_3608
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bind_3608
  Amino acid metabolism
   00310 Lysine degradation
    Bind_3608
Enzymes [BR:bid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bind_3608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4091690..4092907
Genome map
AA seq 405 aa AA seqDB search
MTTEIRVPTLGESVTEATIGKWFKKAGDAVKADEPLVELETDKVTLEVNAPAAGVLGEIV
AKDGDTVGVGALLGQIVESGAGAAPAAAKPAALAPAPTPAAAPAPAPSAGLPPSPAAAKV
AADAHVDTQAIDGSGKRGQVLKGDVLDYVAKGAAPAAAPAPVIARAPAPQEDGAREERVR
MTKLRQTIARRLKDAQNTAAMLTTFNEVDMTEVMALRAKYKDIFEKKHGTKLGFMGFFVK
ACVAALKDIPAVNAEIDGTDLIYKNYYHLGIAVGTDKGLVVPVVRDADQLSIAGIEKTIA
GYGKRARDGQLKIEEMQGGTFTITNGGIYGSLMSTPILNAPQSGILGMHKIQDRPMVVGG
KIEIRPMMYLALSYDHRIVDGKEAVTFLVRVKEELEDPARLVLDL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgaaatccgcgtccccactttgggagaatctgtgaccgaggcgacgatcggt
aaatggttcaagaaggcgggcgatgccgtcaaggcggacgagccgctggtcgaactcgaa
accgataaagtcacgctcgaagtcaatgcgccagccgctggcgtgctcggtgagatcgtt
gccaaggatggcgacacggttggcgtcggtgccctgctcggacagatcgtcgaaagcggc
gctggcgccgcgccggccgcggccaagcctgctgctcttgcacctgctcccactcctgcc
gccgcgcctgctccggccccgagtgcgggtctgccgccgtcacccgccgccgccaaagtt
gcggccgatgcccatgtcgatacgcaggcgatcgatggctccggcaaacgcggccaggtg
ctgaaaggcgatgtgctcgattatgtcgccaagggcgcggcgcctgctgcggctccggcc
ccggttatcgcccgtgcgcccgcgccgcaggaagatggtgcgcgtgaagaacgggtgcgc
atgaccaagctgcgccagaccatcgcgcgccgcttgaaagatgcgcagaataccgccgcc
atgctcacgaccttcaacgaggtcgacatgaccgaggtcatggccctgcgcgcgaaatac
aaggatatttttgaaaagaagcacggcaccaagctcggcttcatgggctttttcgtgaag
gcttgcgtcgcggccttgaaggatattccggccgtcaatgccgagatcgatggtaccgat
ctcatctacaagaactattaccaccttggcattgcggttggcaccgataagggtctcgtc
gtgcctgtcgtgcgtgacgctgatcaattgagcatcgccggcatcgaaaagacgatcgcg
ggttatggcaaaagggcgcgcgacggtcagttgaagatcgaggaaatgcaaggcggcacg
ttcacgatcaccaatggcggcatttacggctccctgatgtcgacgccgatcctgaatgcg
ccgcagtcgggcattctcggcatgcacaagatccaggaccggccgatggtcgtcggcggc
aagatcgagatccggccgatgatgtatctggctctgtcctatgatcaccgtatcgtcgac
ggcaaggaagccgtgaccttcctcgtccgcgtcaaggaagagctggaagatccggcccgc
ctggttctcgatctctga

DBGET integrated database retrieval system