KEGG   Beijerinckia indica: Bind_3641Help
Entry
Bind_3641         CDS       T00688                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bid  Beijerinckia indica
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bind_3641
Enzymes [BR:bid01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bind_3641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4130606..4131607
Genome map
AA seq 333 aa AA seqDB search
MKFITTDQNPLPPSGTVGEIVTADRIVLRYARWPAQDSAGRGVRGTIAILGGRAEFIEKY
FETIAALQKRGFAVALLDWRGQGLSQRLLRNRSKGHVDDFKSYRKDLDAFEQQVLAPFCP
KPWFALAHSMGGTILLDQAHDGASPFTRMVLCAPMIALKRLSFPRGMRFLTEFLHKSGFG
RAGVPFRYARAAAREPFSKNVLTSDPVRFSRFTSVIAAAPELAVGVPTIGWVHAAFRLMH
KLAKPDFAARVTTPVLIFVAGDDRVIDSRSVELFASRLKTGHCLTIPNAQHEILMEQDCY
REQFWAAFDHFILGSPEEVLKPRDEPLIVQTAV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattcatcacgactgaccaaaatcctcttccgcccagtggcacggtcggcgagatt
gttacggccgataggattgtccttcgctatgcccgctggccggctcaggactctgcgggg
cggggcgtgcgagggaccattgccatcttgggcgggcgagccgaattcattgagaaatat
ttcgagacgatagccgcgctccagaagcgtggtttcgcggtcgcccttctcgactggcgc
ggacaaggtctatcgcaacgcttgctgcgtaatcgcagcaagggtcacgtcgatgatttc
aaatcctatcgcaaggatctcgatgccttcgaacagcaggtgctcgcacctttttgtccg
aagccctggtttgcgctcgctcattccatgggaggcaccattctgctcgatcaggcgcat
gacggagcttctcctttcacacgcatggttttgtgtgcgccgatgattgcgctcaagcgc
ctgtcctttccgcgcggcatgcggtttttgactgaattccttcataaaagcggcttcggc
cgtgccggcgttcccttccgctatgcgcgtgctgctgcccgcgagcccttctcgaaaaat
gtcctgacctcggatccggtccgcttctcgcgatttacctcagtgattgccgcggcaccg
gaattggctgtgggtgtgccaacgattggctgggtacatgcggccttccgtctgatgcac
aagctggccaaacccgatttcgccgcgagagttacaacgccagtcctgatcttcgtcgct
ggcgatgatcgcgtcattgattcacgttcggtggaactgtttgccagtcgtctcaagacg
ggtcattgcctgacaatcccgaacgcccagcatgagatcttgatggaacaggattgctat
cgcgaacaattctgggctgctttcgatcatttcattctcggttcgccagaagaggtgttg
aaaccacgggacgagccgctcatcgtccagacagccgtttga

DBGET integrated database retrieval system