KEGG   Bacillus infantis: N288_01985Help
Entry
N288_01985        CDS       T02860                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bif  Bacillus infantis
Pathway
bif00220  Arginine biosynthesis
bif00250  Alanine, aspartate and glutamate metabolism
bif00471  D-Glutamine and D-glutamate metabolism
bif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bif00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N288_01985
   00220 Arginine biosynthesis
    N288_01985
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    N288_01985
Enzymes [BR:bif01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     N288_01985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AGX02364
UniProt: U5L4A7
Position
334973..335902
Genome map
AA seq 309 aa AA seqDB search
MACRSSDELKKLVEEARKETVHGRVADYIPALGKADPGDLSIAIQYPGGECVSAGDVEEK
ITLQSVSKVISLAYVLMERGPGYVFDRVGMEPTGDPFNSIAKLETMAPAKPLNPMINAGA
LVVTHMVEGSSPDERFEKLLGFVRRLADDETIGYCREVAESELRTADLNRALCYFLKQHD
VIQEDVEDLLDLYTRQCAIEMNCLNLARIGLVFALDGKDPRTGGEIMPRDIARICKTFMV
TCGMYNASGEFAIKIGIPAKSGVSGGIMGAVPGRFGIGIFGPALDERGNSIAGIRLLELL
SKNYSLSMF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcatgccgttctagtgatgaattaaaaaaactggttgaggaagcgcggaaggagacg
gtgcacggaagggtggccgattatatccctgcgcttggtaaggcggatccgggggattta
tccattgcgatccaatatcctggcggcgaatgcgtctctgccggtgatgttgaggaaaag
attacgcttcaaagtgtgtcaaaagtaatcagcctggcctatgttttaatggaaaggggc
cctggttatgtgttcgaccgtgtggggatggagccgacgggcgatccgttcaactcgatt
gccaagcttgagaccatggcgcctgccaaacccctgaatcccatgattaatgcaggggcg
cttgtcgttacacacatggtggaaggaagttctcctgatgaacgtttcgaaaagcttctt
ggtttcgtccggcggctcgcagatgatgaaacgatcggctactgccgggaagtagcagag
tccgaattgaggacagccgacctgaacagggcgctttgctatttcctgaagcagcatgat
gttatccaggaagatgtagaagatctgctcgacttatatacgaggcagtgtgctattgaa
atgaactgcctgaacctggcgaggattggccttgtttttgcactggatggaaaagacccg
cggacaggcggggaaatcatgcctagggacatcgcgcggatctgcaagacctttatggta
acctgcggcatgtacaatgcttcaggcgaatttgcgatcaaaatcgggatcccggcgaaa
agcggtgtttcaggagggatcatgggtgcggtccctggccgttttggcattggcatcttc
gggccggcccttgatgagaggggaaacagtattgcagggatccggcttttggaactgctg
tcgaagaattacagtttaagcatgttttaa

DBGET integrated database retrieval system