KEGG   Bacillus infantis: N288_02790Help
Entry
N288_02790        CDS       T02860                                 

Definition
thermostable monoacylglycerol lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bif  Bacillus infantis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
479803..480546
Genome map
AA seq 247 aa AA seqDB search
MADNYPVLNGAEPFYYEGGRTGILVSHGFTGSTQSMRPLGEAYAKAGYTVCGPRLKGHGT
HYEEMEQTQYSDWIASIEEGFQWLKERCDDIFVTGLSMGGTLTLYMAEKHSEIKAIIPIN
AAVEISDMEGAAALQDARFLDAIGSDIKKADVKELAYEKTPVKSIGEIVQLMELVKGGLA
DIQCPALIFVSSEDHVVPPDNSRLILDRISSKDKKLITMENSYHVATLDNDQQLIIDETL
AFIKKYQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggcggataactatccagtattaaacggagcagaacccttttattatgaaggcggcagg
acaggcatcctggtttcgcacggttttacaggctcgacacaaagcatgcggccgctcggg
gaggcatatgcgaaagcaggctatacggtctgcggcccaaggcttaaaggccatgggacc
cattatgaggaaatggagcaaacgcagtacagcgactggattgcaagcattgaagaaggc
tttcaatggctgaaagaacggtgcgacgatattttcgtcacaggcttatccatgggaggg
acacttactctttatatggctgagaagcattccgaaatcaaggccattatcccaattaat
gctgccgtagagatttcggatatggaaggtgctgcagcccttcaggacgcccgcttcctc
gatgccatcggctcagatataaagaaagctgatgtaaaagagctggcctatgagaagacc
ccggtcaaatccatcggtgaaatcgtccagttaatggagctggtaaaaggagggctggct
gacatacagtgcccggcattgatttttgtttccagcgaagaccatgttgtcccgcctgat
aattcccggctcatccttgaccgcatctcaagcaaagacaaaaaactgattacgatggaa
aacagctatcatgtcgccacgctcgataatgatcagcagctgatcattgatgagaccttg
gcgtttataaaaaaatatcaataa

DBGET integrated database retrieval system