KEGG   Bacillus infantis: N288_06710Help
Entry
N288_06710        CDS       T02860                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bif  Bacillus infantis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bif00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    N288_06710
Enzymes [BR:bif01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     N288_06710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1205506..1206891
Genome map
AA seq 461 aa AA seqDB search
MKTAVVIGGGITGLSAMYYLQKLKREKNLPLNLILAEKGGELGGKIATVKRGEYIMETGA
DSVVARNESILRLLDELKLHEEVVYNATGTSYLYSKNRLVKIPEDTVFGIPTSVQSLFSS
PLISFKGKVRALKDLVSKNKEFTKDSSIGLFLESFLGRELVEYQVSPVLSGVYSGKLNEL
TMATTLPYLLEYKNKYGSIIRGLSENKKKFQSSGSKKFISFKGGLSALIDRLEEALTEAE
ILKGAAVEKIEKHGGQYTIAFSNRESITADYVILSTPHDAAEKLLRDDRLDPAFAELKNS
SLTSIYLGFDIPDSELPADGTGFIVSEGSDLKCNACTWTSRKWSHTSERHQLLLRLFYKS
SNPNYAYLNGLDRDGFVEEALNDVKKSLGISAQPAMVEVTRWNNLMPNYSLKHGEAVESL
TDSLTEHYPNVLIAGCSYYGVGIAACIANGQKTAEMIAEKI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaagacagcagtggtaatcggcggaggcatcaccggactttctgccatgtattatctg
caaaagctgaagcgggaaaagaacctgccgcttaacctgatactcgcagaaaaaggcggg
gaactgggaggcaagattgcgactgtaaaaagaggcgaatatatcatggaaacaggggcg
gattcggttgttgcccgaaatgaaagcatcctccggttgctggacgagctgaagctgcat
gaagaagtggtctacaatgcaaccggcacatcctatctatattcgaaaaaccggctggtg
aaaatccccgaagacactgttttcggcatcccgacaagtgtgcagtcattattcagcagc
ccgctgatttcctttaaaggaaaagtgcgtgccctgaaggaccttgtcagcaaaaataag
gaattcacaaaggacagctcaatcggccttttccttgaaagctttctgggcagggagctg
gtcgaataccaggtttctcctgttctgtcaggcgtctattcagggaagctgaacgagctg
acgatggccacgacgcttccttacctgcttgaatataaaaataaatacggcagcattatc
cgcggactgtccgaaaataaaaagaagtttcaatcctccggcagcaagaagttcatttcc
tttaaaggcggactatctgccctcatcgacaggctggaggaagcattgacagaagctgaa
attcttaaaggggcggcggtcgaaaaaatagagaaacatggcgggcaatacacgattgct
ttttccaacagggaaagcattaccgcagactatgtgatcctgagcactccccatgatgca
gccgaaaagctgcttcgggatgaccgcttggatcctgcatttgccgagctgaagaactct
tctctcacaagcatctatcttggtttcgatatccctgacagcgagctgcccgcagatggc
acaggcttcattgtttctgaaggaagcgatcttaagtgcaatgcctgcacatggacgagc
cgaaagtggagtcacacttcagagaggcaccagcttctgctccggcttttctacaaaagc
tccaatccaaattatgcatacctgaacgggctggacagggacgggtttgtagaagaagca
ttgaatgatgtgaaaaagagcctcggtatttctgcacagccggccatggtggaagtgaca
cgctggaataatctaatgccgaactattcgctcaagcatggggaagctgtggaatcgctg
actgacagcctgacagaacattatcctaatgtcctaatcgccggctgttcttattatggt
gtaggcattgctgcctgcatcgccaacggccagaaaaccgctgaaatgattgcggaaaaa
atatag

DBGET integrated database retrieval system