KEGG   Bacillus infantis: N288_08085Help
Entry
N288_08085        CDS       T02860                                 

Definition
protein-glutamine gamma-glutamyltransferase
Orthology
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
bif  Bacillus infantis
Brite
Enzymes [BR:bif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     N288_08085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1464245..1465132
Genome map
AA seq 295 aa AA seqDB search
MNKPCRGIDRTEWPAILKMAGFSAERGQNSGHFKEHSAIRYREAVLGKEFSMIQLPVFPG
LSADMLPETQRAIWQALDRSPETFYYSNAGELLFELETREKILYYSRKLSESGAVFAAFQ
DSFFNPAYWIKTRAGYALRPDVRPSEAVNDVFSNGSKYAFECSTAIVLILYKAVLESISV
RYFNQLFQNLLVWDWNYDRDLGIVTKIGSNFIPGDIVYFYNPDFRHPVWTGENAVYLGND
AYFGHGIGIKSEQEMVAALNTLRKPNATRSAFLISQHSRINFSYLFQFAKRIQGF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccctgcagggggattgacaggacagagtggcctgccatcttaaagatggca
ggcttttctgcggaaagaggccaaaactcagggcattttaaagagcactctgccataagg
tatagggaagccgtacttggaaaggagttttctatgatacagctgcccgtatttccaggc
ctgtccgccgatatgctgccagaaacccaaagggctatatggcaagctttagatagaagc
ccggagacattttattattcaaatgccggtgagctattgtttgagctggaaacgagggaa
aagatcctgtactactcgaggaagctgagtgaaagcggcgctgtatttgccgcctttcaa
gactcattcttcaatccggcatattggataaaaacaagggcgggatatgccttaaggccg
gacgtccgcccttctgaagcggtcaacgatgttttttccaatggcagcaaatatgctttt
gaatgttcaacggccatcgtgcttatcttatacaaggcagtgcttgagtctatttctgtc
cgctacttcaatcagctgttccaaaatctgctcgtatgggattggaattatgacagagat
ctgggcattgttacaaaaataggatcaaactttattccaggcgacattgtctatttttat
aatcccgatttccggcatccggtctggacgggggagaatgcggtctatctgggcaatgat
gcttattttgggcatggaattggcatcaagtcagagcaggaaatggttgctgccctcaat
acactcaggaaaccaaatgccaccagatcagcattccttatctcccagcatagcaggatc
aatttcagttatttatttcaatttgctaaaaggatccaggggttttag

DBGET integrated database retrieval system