KEGG   Bacillus infantis: N288_10480Help
Entry
N288_10480        CDS       T02860                                 

Definition
protein-glutamine gamma-glutamyltransferase
Orthology
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
bif  Bacillus infantis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1935350..1936180)
Genome map
AA seq 276 aa AA seqDB search
MIQISGVSFQIQENGQLGSVEKTILQQMQSAPVLYSYNSEYELLFELTVRKNIIQSAKEM
DKSQAVFTSFEYARCNPRYWQLTRAGGFLLRPDVRPADAIIDIFRNGSFYAFECATAIPI
IYYHAILNSIDSERFNSLFQNLYLYSWHTDTDLGIITFYSDHFIPGDVLYVNNPDFDRKT
PHFRGVNAVLLEDGRLFGHGFNIRTSEEMIRLLNETRKPDSQQSAYITKLVTRPSFKYLL
RAAGWQRNSAAYKPQRPIVHHNKSSISYVHYLYYSI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgatccagatatcaggggtatcttttcaaattcaagaaaatggccagcttggaagtgtt
gagaagacgatcctgcagcagatgcagtctgcaccagttttgtattcttataattccgag
tatgaattactttttgagcttacagtgcgcaagaacattattcaaagcgcgaaagaaatg
gacaaaagtcaggctgtgtttacaagctttgaatatgcccgctgcaatcccaggtactgg
caattaacaagagcaggcggatttcttttaaggcctgatgtgcggccggctgatgcaatt
atagatatttttcgaaacggttcattttatgcatttgaatgcgcgacagctattccaatc
atctattaccatgccatattgaatagtatcgacagcgaaaggtttaattcactgtttcaa
aatctttatctttacagctggcatacagatacagacctgggcatcatcaccttttactct
gatcattttatacctggagacgtcctgtacgtaaataatcctgactttgatcgaaaaaca
ccacatttcaggggtgttaatgctgtgctccttgaggatggcaggctgtttggacacgga
tttaatattagaacatcagaagaaatgattcggctccttaatgagacgagaaaaccggac
agtcagcaatcagcatatataacaaaattggtgaccaggccttctttcaagtatttatta
agagcggcaggctggcaaaggaacagtgcagcatacaaaccccagcgtccaatcgtgcac
cataacaaaagctccatttcatatgtacactatctctattattcgatctaa

DBGET integrated database retrieval system