KEGG   Bacillus infantis: N288_10755Help
Entry
N288_10755        CDS       T02860                                 

Definition
carbohydrate esterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bif  Bacillus infantis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bif00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    N288_10755
   00500 Starch and sucrose metabolism
    N288_10755
Enzymes [BR:bif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     N288_10755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1994451..1995392
Genome map
AA seq 313 aa AA seqDB search
MTFKESVTKPLKMTVAKDGKGAYQTVQEAIDAIPADNKNKVEIFIKNGVYKERIVVPANK
PFVTLIGESVENTILTYDNHAKIMSPDGGIIGTRNSASVFLYAGDFTARNLTFENSFNPK
RLEEETQAVAVYASGERMEFYQVRFLGNQDTLYLKEGSQYFSRCYIEGDIDFIFGGARAV
FKECEIFSLNRGSSAENGYISAASTHINEPYGFLFLNNRFTSSAAKGTVYLGRPWHPGGD
PEAIASVIFKNNYLGAHIHPDGWTDMSGFSAKDARFYEYMNEGPGSNPDRPQLTDEEAEA
ANIETVLKGWNPE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaaagaaagtgtaactaaaccattaaaaatgactgtagccaaagacgggaaa
ggtgcttatcagaccgttcaagaagcgattgatgctataccggctgataataaaaataaa
gtggaaatctttattaagaacggagtatataaggaacgaatcgtagttccggcaaataaa
ccatttgtgacgctaattggagaaagtgtcgagaacacaatcctcacttatgataaccat
gcaaaaataatgtcccccgatggcggtatcattggaacacgcaatagcgcaagtgtattc
ctttatgcgggggattttacagccagaaaccttacctttgaaaactcattcaatccaaaa
cgcttggaagaagagacacaggcggtagctgtttatgccagcggtgagagaatggaattt
taccaggtgcggtttctgggaaatcaagatacactttacctaaaagaggggtctcagtat
tttagccggtgttatattgaaggtgatattgattttatttttggaggggcaagagcagtt
ttcaaagaatgtgagatcttttctttgaatagagggtcttctgcagaaaacggatatata
tcagctgcaagtacccatataaatgagccatatggattcctgtttttaaacaatcgattt
acaagctcagcggccaaaggaacggtctatcttggaaggccctggcaccctggcggggat
ccggaggccatagcaagcgtcatattcaaaaataattatttgggtgcccacattcatccg
gatggctggactgacatgtcaggcttcagtgccaaagatgcaagattctatgaatatatg
aatgaaggacctggctcaaatcccgataggcctcagcttacagatgaagaagctgaagca
gccaacatcgagactgtgttaaaagggtggaatccggaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system