KEGG   Bacillus infantis: N288_10755Help
Entry
N288_10755        CDS       T02860                                 

Definition
carbohydrate esterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bif  Bacillus infantis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bif00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bif00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1994451..1995392
Genome map
AA seq 313 aa AA seqDB search
MTFKESVTKPLKMTVAKDGKGAYQTVQEAIDAIPADNKNKVEIFIKNGVYKERIVVPANK
PFVTLIGESVENTILTYDNHAKIMSPDGGIIGTRNSASVFLYAGDFTARNLTFENSFNPK
RLEEETQAVAVYASGERMEFYQVRFLGNQDTLYLKEGSQYFSRCYIEGDIDFIFGGARAV
FKECEIFSLNRGSSAENGYISAASTHINEPYGFLFLNNRFTSSAAKGTVYLGRPWHPGGD
PEAIASVIFKNNYLGAHIHPDGWTDMSGFSAKDARFYEYMNEGPGSNPDRPQLTDEEAEA
ANIETVLKGWNPE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaaagaaagtgtaactaaaccattaaaaatgactgtagccaaagacgggaaa
ggtgcttatcagaccgttcaagaagcgattgatgctataccggctgataataaaaataaa
gtggaaatctttattaagaacggagtatataaggaacgaatcgtagttccggcaaataaa
ccatttgtgacgctaattggagaaagtgtcgagaacacaatcctcacttatgataaccat
gcaaaaataatgtcccccgatggcggtatcattggaacacgcaatagcgcaagtgtattc
ctttatgcgggggattttacagccagaaaccttacctttgaaaactcattcaatccaaaa
cgcttggaagaagagacacaggcggtagctgtttatgccagcggtgagagaatggaattt
taccaggtgcggtttctgggaaatcaagatacactttacctaaaagaggggtctcagtat
tttagccggtgttatattgaaggtgatattgattttatttttggaggggcaagagcagtt
ttcaaagaatgtgagatcttttctttgaatagagggtcttctgcagaaaacggatatata
tcagctgcaagtacccatataaatgagccatatggattcctgtttttaaacaatcgattt
acaagctcagcggccaaaggaacggtctatcttggaaggccctggcaccctggcggggat
ccggaggccatagcaagcgtcatattcaaaaataattatttgggtgcccacattcatccg
gatggctggactgacatgtcaggcttcagtgccaaagatgcaagattctatgaatatatg
aatgaaggacctggctcaaatcccgataggcctcagcttacagatgaagaagctgaagca
gccaacatcgagactgtgttaaaagggtggaatccggaatag

DBGET integrated database retrieval system