KEGG   Bacillus infantis: N288_11915Help
Entry
N288_11915        CDS       T02860                                 

Definition
hypothetical protein
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
bif  Bacillus infantis
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bif00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    N288_11915
   00330 Arginine and proline metabolism
    N288_11915
   00340 Histidine metabolism
    N288_11915
   00350 Tyrosine metabolism
    N288_11915
   00360 Phenylalanine metabolism
    N288_11915
   00380 Tryptophan metabolism
    N288_11915
Enzymes [BR:bif01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     N288_11915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2225947..2227359)
Genome map
AA seq 470 aa AA seqDB search
MDRFEMKQHAIAIIGAGLAGLTCAFRLKQAGIEAVVFESQADAGGRCRTDRAIFAEGQFA
ECGGEFIDSNHKEIMGLISELGLQTDDLTSFEKKGGKPLYLINGKSIPGEKIEDLYSRIA
DTVREEYRLCEFPPLYNRHSKRAKELDSMSIVDWINQNIEGGTGSEFGQLLCDAYTIEYG
ADCAEQSALNLISLVGGLNGSHFNVFGTSDERYRVRGGNDLIIEKLKQKLDGSILYDHQL
TSIRSLGQGGYHLGFQSAGKRKEVYAGKVVMAIPFTVLKQTDYTKSGFSPLKAKAIEELG
MGHNLKAHFQFSSRFWEKFASTGTIYTNDMFQSAFEATRAQKGDAGILVHYAGGKEAVRL
MKEGKEKHKRRFLQDLSRLFTGAADQFNGRDLISYWIAGSWTGGSYSFRKVGQHTGFAGV
EMEKEGSCYFAGEHTSILYQGYMNGAVESGGRAALEVQMDLLDEHHKGTL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggacaggtttgaaatgaaacagcatgctattgccatcatcggtgccggactcgcaggt
cttacctgtgctttccggctgaagcaggcaggaatcgaagctgtggtatttgaatcacag
gcagacgcaggcggcagatgccggacagaccgggctatttttgcggaagggcagtttgct
gaatgcggaggagagttcattgattccaaccataaagaaataatgggcttgatctctgaa
ctcggtttgcagacagatgaccttaccagcttcgaaaaaaaagggggaaagccgctttat
cttattaatggaaaaagcatccccggagaaaagatcgaggatctctacagccggatagct
gacactgtcagagaagaatacaggctttgcgaattccctccgttgtataacaggcattct
aagcgtgcgaaagagctggacagcatgtcgatcgtggactggatcaatcaaaatatagag
ggaggaactggctctgagttcggccagcttttatgcgatgcatacacaatcgaatatggg
gcagattgtgctgaacagagcgcacttaatctcatcagccttgtaggagggctgaatgga
tcgcatttcaatgtattcggcacctctgatgaaagatacagggtgcggggcgggaacgac
ctgatcattgagaaattaaagcaaaaactggacgggtctatcctttatgaccaccagctt
acaagcatcagatccctcgggcagggcggatatcaccttggatttcaatcggctgggaaa
aggaaggaagtctatgcaggcaaagtcgtgatggccattccctttactgttttaaaacaa
accgattacacaaagagcggcttcagccctctaaaagcaaaagcaatagaagagcttggc
atgggtcataatttaaaagcacattttcaattcagcagcagattttgggagaagtttgcc
agcaccggaacaatctataccaatgatatgttccaatctgcctttgaagctacccgggca
caaaagggggatgccggaatccttgtacattatgcaggcggaaaggaagccgttcggtta
atgaaagaaggcaaggaaaagcataagcggagattccttcaggatttgtcacggctgttc
acaggtgcagcagaccaatttaatggcagggatttgatatcctactggattgccggcagc
tggactggaggttcctattccttcaggaaggtcggccagcacaccggttttgcaggagtt
gagatggagaaggaaggaagctgctattttgccggggagcatacatccatcctttatcag
ggctatatgaatggagcagtagagagcgggggcagggcagcacttgaagtgcagatggac
cttttggacgaacatcataaaggcactctataa

DBGET integrated database retrieval system