KEGG   Bacillus infantis: N288_12105Help
Entry
N288_12105        CDS       T02860                                 

Definition
(GenBank) penicillin-binding protein
  KO
K12555  
penicillin-binding protein 2A [EC:2.4.1.129 3.4.16.4]
Organism
bif  Bacillus infantis
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bif00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N288_12105
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    N288_12105
Enzymes [BR:bif01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     N288_12105
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     N288_12105
Glycosyltransferases [BR:bif01003]
 Polysaccharide
  Bacterial polysaccharide
   N288_12105
Peptidoglycan biosynthesis and degradation proteins [BR:bif01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   N288_12105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2263339..2265408)
Genome map
AA seq 689 aa AA seqDB search
MERLKQVWEYIKRFWKRKHITQILLLAALTALLLAILFFAYLAATANVQSLKDGLKQSTV
LYDKDGDEAGKLAANRTGGAKIEELPDHMKEAVVSIEDERFYKHNGFDIKGIARAFFSNL
FAGRITGGGSTITQQLAKNALLSPEQTYRRKAEEIFLAVEIEKNYKKEDILLMYLNQVYF
GSGAWGIDRAARTYFNKPISGVTISEAALLAGLLQSPSALDPYQHYDRSISRRDTVLGKM
QELGYISKDEYEKAIAEKIVLEDGSSNTEARKYPYYVDAVLDEATSKYGLTQEEIFTRGY
TIYTELDQNIQSGLEKVYDRDSLFPAGRGGQLVQSGSVLLDPSTGGVRAIVGGRGEHVFR
GFNRGTHIKAQPGSTLKPLSVYTPAIEEGYDASSILKDEPMTFGNYKPENFSRTYAGEVP
MYKAVEESLNIPAVWLLNEIGIDKGMDSLKRFGIPTEKEDRALGIALGGMRKGISPLQLA
QAYAAFPNEGKRHDAHFITKIVGPTGNVIAERKKKTVKVTSKAAAREMTSMLLNVVESGT
GQRTRIPEVQIAGKTGSTQLPYNDIDGTKDQWFVGYTPSLVGAVWLGYDKTDREHYLSTS
SSETVVPIFKSIMEQVLPYTEQKDFGTESVNDQLAEEAEPDIDLQERAEEFSKRLKEDLP
EWKEKWQDARELLDKTEEKLNEIWDKIGS
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggaaagactcaaacaggtctgggaatatatcaaacgcttttggaagagaaagcatatc
acacagatcctgctgcttgccgccctgacggccctgctgctcgccattttgttttttgcc
taccttgcagccacggccaatgtccaatccttgaaggatggcctgaagcagtcgaccgtc
ctttatgataaagacggagatgaggccggaaagcttgccgccaacaggaccgggggagca
aaaatagaagagttgcctgaccatatgaaggaagctgtcgtcagtattgaggacgagcgt
ttttacaagcataatggctttgatataaaagggattgcaagggcctttttcagtaatttg
tttgcagggaggatcactggcggcggcagcaccatcacacagcagctcgccaaaaatgca
ttgctgtcgccggaacaaacatacagaagaaaagctgaggagattttcctggcggtcgaa
atagaaaagaattacaaaaaagaagatatcctgctgatgtacctgaaccaggtttatttt
ggcagcggggcatggggcattgacagggccgcaagaacctatttcaataaaccgataagc
ggagtcaccatcagcgaagcagcgctgcttgcgggactgctgcagtctccatcagcatta
gatccttaccagcattatgacaggagcataagcaggcgtgacacggtgcttggaaaaatg
caggaacttggatacatctcaaaggatgaatatgaaaaggctatcgcggagaaaattgtc
ctggaagatggaagttcaaacacagaagcaagaaagtatccctattatgtagatgcagtc
cttgatgaggcaacaagcaagtatggccttacccaggaggagatatttacaagaggctat
accatttatacagaactggatcaaaatatacaatccggccttgaaaaggtatatgacaga
gattcccttttccctgcaggcagaggaggacagctggtgcagagcggctcagtcctatta
gatccgtcgaccggcggtgtccgtgccattgttggaggccggggtgagcatgtattcaga
ggctttaacagagggacacatataaaggctcagccagggtccaccttaaaaccgctctca
gtatatacacctgctatagaagaaggctatgatgcttcatctatcctgaaggatgagccg
atgacattcgggaattataagccggaaaatttctcgcggacgtatgccggcgaggtgccg
atgtataaagcagttgaagaatcgcttaacattcctgctgtctggctgctcaatgaaatc
gggattgataaaggcatggattctttaaagcgctttggaatcccgactgagaaggaagac
agagcgcttggcatcgctcttggcggaatgagaaaaggaatttcgccgctgcagctcgca
caagcatatgccgcttttcctaacgaaggaaaaaggcatgatgcccactttattaccaag
atagtcggaccgacagggaatgttattgctgaaagaaagaaaaaaacggtcaaagtcact
tccaaggcagcggcaagggagatgacatccatgctccttaatgttgtcgaaagcggaacc
ggccaaaggaccaggattccggaagtacagatagcgggaaaaaccggctccacacagctg
ccttacaatgatatcgacggcacgaaggatcaatggtttgtaggctatacaccttcattg
gtaggtgctgtatggctaggctatgataaaacagacagggagcattatttatcaacaagc
agctctgaaactgtagtgcctattttcaaaagcatcatggagcaggtgctgccttataca
gaacagaaagattttggaacagagtcagttaatgatcagctcgcagaagaagctgaacct
gatatcgatcttcaggagcgggctgaggaattcagcaagcgattgaaggaagatttgccg
gaatggaaagaaaaatggcaggatgcacgggagctgctcgataaaacagaagaaaaacta
aatgagatttgggacaaaattggaagttag

DBGET integrated database retrieval system