KEGG   Bacillus infantis: N288_19560Help
Entry
N288_19560        CDS       T02860                                 

Definition
5-hydroxymethyluracil DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bif  Bacillus infantis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bif03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3591747..3592574)
Genome map
AA seq 275 aa AA seqDB search
MPELPEVETVRKTLKELVTGKEIGQVSIHWPKMIKQPGEAEQFADALAGQTILDVGRRGK
FLIIYTDDYALVSHLRMEGKYALYSKEEDKDKHTHVIFHFTDGSELRYRDVRKFGTMHLF
AKGEEFASLPLSQLGPEPFSEEFTPQFLQQRLAGTNRAVKTALLDQKAVVGLGNIYVDEA
LFRAGIHPERLASSLSDDEIGRLHKEIVATLSEAVEKGGSTIRSYVNSQGQIGMFQLELF
VYGRKGEACKTCGSTLERIIVGGRGTVFCPVCQVK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattgcctgaagtagaaacagtcaggaaaacattgaaagagcttgtcaccggc
aaagaaatcgggcaagtgtccatccattggccgaagatgatcaagcagcctggtgaagct
gagcagtttgccgatgcgcttgccggacagactatcctggatgtcggaaggcgcggaaag
ttcttgatcatttatacagacgattatgctttggtttcccatctccgcatggaaggcaag
tatgctctctattcaaaagaagaggacaaggataagcatacccatgttatcttccatttc
acagacggttctgaactccgctacagggatgtaaggaagttcgggacaatgcacctgttt
gccaagggagaggagtttgcgagtctgcccctttcccagctggggcctgagccgttttcg
gaagaatttactccccagtttctgcagcagcggctggccggcaccaatcgagcggtcaaa
actgcccttttagatcagaaagcagtcgtcggacttgggaatatctacgtggatgaggcg
ctgttcagagcgggcatccaccctgaaaggctggccagttctctttctgatgatgaaatc
ggcaggctgcataaggagattgtcgccacactttctgaagcagttgagaaggggggcagc
accatcaggtcttatgtgaattcacagggccagatcggcatgttccagctcgagcttttc
gtctacgggcgaaaaggagaggcatgcaaaacatgcggcagcacactcgaaagaatcatc
gtcggcgggcggggcacagtcttctgccctgtgtgccaggtgaagtag

DBGET integrated database retrieval system