KEGG   Bacillus infantis: N288_20455Help
Entry
N288_20455        CDS       T02860                                 

Definition
(GenBank) glycogen branching protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bif  Bacillus infantis
Pathway
bif00500  Starch and sucrose metabolism
bif01100  Metabolic pathways
bif01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bif00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    N288_20455
Enzymes [BR:bif01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     N288_20455
Exosome [BR:bif04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N288_20455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: AGX05963
UniProt: U5LEX3
Position
complement(3776316..3778226)
Genome map
AA seq 636 aa AA seqDB search
MHLFHEGTLFDSHRLFGAHVIFEDGKTLTRFAVWAPNAKEVRVVGDFNSWNGDDFKLHRM
NNEGVWHIVIEKDLAGCLYKYEILTQEGTRLHKADPYAFYSEKRPGTASVVWPLEGYKWN
DQSWLKGRMKKNTFAEPAVIYEMHAGTWKRNNGNSLLNYRELADEIVPYVLEHGFTHVEL
LPLVEHPLDASWGYQGTGYFSPTSRYGKPQDFMYFVDQCHQHNIGVILDWVPGHFCKDAH
GLYKFDGTHLFEYKNEKDRENYVWGTSNFDLGRNEVQSFLISNALFWLETYHIDGFRMDA
VSNIIYWPNSHEQHQNPYGIEFLRKLNSTIRQYDPSIFLAAEDSSNLPQVTSPAHYGGLG
FHYKWNMGWMNDVLAYMETSPEARSGKHGNITFSLLYAFKENFILPLSHDEVVHGKKSLL
NKMPGDYWRKFAQFRLLLGYMMAHPGKKLLFMGFEIAQFSEWKDSEELDWNLLDYEMHQK
ANRYTKDLIRLYRRSRPLFELDHVQEGFEWIDADNREQSIFSFVRFSAAEGEHLIAVCNF
TADPYRNFRIGVPHAGSYREIFNSDKEEYGGSGWINKKVVKTEELEYHGRPYSIQMAIPP
FGITILRPVKHRKERKGNGKDKMCGHAAGRGKRIKA
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgcatttatttcatgaaggcaccctttttgacagccaccgtctttttggtgcccacgta
atatttgaagatggcaagaccctaaccaggttcgctgtatgggctcctaacgccaaggaa
gtcagggttgtaggggactttaacagctggaatggggatgatttcaaattacatagaatg
aataatgaaggggtatggcacatagtaattgagaaggatttggcaggctgcctctataag
tatgaaatattgacacaagaaggcaccaggctgcacaaagctgatccatatgccttctat
tcagagaaaaggccaggcacagcttcagttgtatggccgcttgaaggctataaatggaat
gaccagtcatggctgaaaggaaggatgaagaaaaatacctttgcagaaccggcagtcatc
tatgaaatgcatgccggaacgtggaaacggaataatggcaacagtctgctgaattacagg
gagctggcggatgaaattgtgccttatgtccttgaacatggtttcacacatgtagaattg
ctccctcttgtcgagcatccgctcgatgcctcctggggctatcaggggacagggtatttt
tctccgaccagccggtatgggaagccgcaggatttcatgtattttgtcgatcaatgccac
cagcataacatcggtgtcatcctggactgggttcccggccacttttgcaaagatgcccat
ggactctataaattcgacggaacccatctctttgaatataagaacgagaaggatagggag
aattatgtatggggcacttcaaactttgacctgggccgaaatgaagtgcagagcttttta
atctccaatgcattattctggctggaaacctatcatatagacgggttcagaatggatgca
gtttctaatattatttattggcccaattcccatgaacagcatcagaatccgtatggaatt
gaattcctccgcaagctcaacagcactatcaggcaatatgatccctccatttttttagca
gctgaagattcatccaatctccctcaggtgacctctcctgcccattatggcggcctgggc
tttcattacaaatggaatatgggctggatgaatgacgtactggcatatatggaaaccagt
ccagaggcgaggtctggaaagcatggcaatattacattttcactcttatacgctttcaag
gaaaactttatattgcctctctcccatgatgaagttgtacatggaaagaagtctctcctc
aataaaatgcctggagattattggagaaagtttgcccagttccggctgctcctgggctat
atgatggcacatccaggtaagaaactgctgtttatgggctttgaaatcgcccaattttca
gaatggaaagattcagaagagcttgactggaatctgctggattatgaaatgcaccagaaa
gcaaacaggtatacaaaggatttgatacggctttacaggaggtccaggcccctatttgaa
ctggaccatgtccaggaaggctttgagtggattgatgcagataaccgggaacaatcgatt
ttctctttcgtccgcttcagtgctgccgagggtgaacacctcattgcagtatgcaacttt
acagccgacccgtatcggaatttcaggatcggagtcccgcatgccggaagctacagggaa
atattcaacagcgataaggaagaatatgggggatccggctggatcaacaaaaaagtagtc
aaaacagaagaactggaataccacggccggccttattcaattcaaatggctatcccgccg
tttggtattactattctgcgtcctgttaaacatagaaaggagaggaaagggaatggcaaa
gacaaaatgtgtggccatgctgctggcagggggaaaaggatcaaggcttaa

DBGET integrated database retrieval system