KEGG   Bacillus infantis: N288_23950Help
Entry
N288_23950        CDS       T02860                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bif  Bacillus infantis
Pathway
bif00071  Fatty acid degradation
bif00072  Synthesis and degradation of ketone bodies
bif00280  Valine, leucine and isoleucine degradation
bif00310  Lysine degradation
bif00362  Benzoate degradation
bif00380  Tryptophan metabolism
bif00620  Pyruvate metabolism
bif00630  Glyoxylate and dicarboxylate metabolism
bif00640  Propanoate metabolism
bif00650  Butanoate metabolism
bif00900  Terpenoid backbone biosynthesis
bif01100  Metabolic pathways
bif01110  Biosynthesis of secondary metabolites
bif01120  Microbial metabolism in diverse environments
bif01130  Biosynthesis of antibiotics
bif01200  Carbon metabolism
bif01212  Fatty acid metabolism
bif02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bif00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    N288_23950
   00630 Glyoxylate and dicarboxylate metabolism
    N288_23950
   00640 Propanoate metabolism
    N288_23950
   00650 Butanoate metabolism
    N288_23950
  Lipid metabolism
   00071 Fatty acid degradation
    N288_23950
   00072 Synthesis and degradation of ketone bodies
    N288_23950
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    N288_23950
   00310 Lysine degradation
    N288_23950
   00380 Tryptophan metabolism
    N288_23950
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    N288_23950
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    N288_23950
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    N288_23950
Enzymes [BR:bif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     N288_23950
Exosome [BR:bif04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N288_23950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AGX06625
UniProt: U5LGM0
Position
complement(4518291..4519478)
Genome map
AA seq 395 aa AA seqDB search
MGRTVIISGARTPFGKMGGALSSLTASDLGAAAVKEALKRADVRPEEVGELILGSVLQGG
QGQIPSRQAGNKAGLPWEVKTETINKVCASGMRSVTLGDQIIRAGDEEVIVAGGMESMSN
APYLLPKARWGLRMGDSTVKDLMIHDGLSCSFTGVHMGTYGNSTAKEMEISREEQDHWAY
RSHQRAVEAIESGRLAEEIVAVEVPQRKGDPLVVKQDEAPRKDTSIEKLAKLAPVFNGDG
TITAGNAPGVNDGAAALVLMSEERAEREGKEVQAYILAHTAIAVEAKDFPKTPGLVINEL
LKKTGKSLDDIDLFEINEAFAAVALTSGKIANLDENKVNVNGGAVAIGHPIGASGARIIL
TLIYELKRRGGGVGIAAICSGGGQGDAIMIEVPAK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggaagaacagtcattattagcggagcacggacaccttttggaaaaatgggaggggca
ttaagcagcctgactgcctctgatttgggagctgcagccgtcaaggaagcattgaagcgt
gccgatgtccgtcctgaagaggttggggagctgattctcggatcggtccttcagggaggc
cagggccagataccttcccggcaggcaggcaataaagccggtcttccatgggaagttaaa
acagaaacgatcaacaaagtctgcgcctcaggaatgaggagtgtgacgcttggcgaccag
atcatcagggccggtgatgaagaagtgattgtggccggcgggatggaatcgatgagcaat
gcgccatatcttttgcctaaagccagatggggcctgcggatgggcgattcgactgtgaag
gacctgatgattcatgacggcctcagctgcagttttacaggcgtccatatggggacttac
ggaaattcaacggcaaaggaaatggaaatatcgcgggaggaacaggaccattgggcatac
agaagccaccagcgggctgtcgaagcgatcgaaagcggcaggctggctgaagaaattgtg
gcagtagaggtgccgcagcgcaaaggcgatccgcttgtcgtaaagcaggatgaagcaccg
cgcaaggatacttccattgaaaagctggcaaagcttgcccctgtattcaatggggatgga
acgatcactgccggtaacgcaccgggagtgaatgacggcgcagccgcacttgtactgatg
agtgaggagcgggctgaacgggaaggcaaggaagttcaggcatatatcctggcccacacg
gcaatcgctgttgaagcaaaggattttccgaaaacaccaggacttgtcatcaacgagctt
ttgaaaaaaacaggcaagtccctcgatgatattgacctgtttgaaataaacgaagcattc
gctgcagttgccctgacgagcggaaagattgccaatctggatgaaaataaagtgaatgtg
aacggcggggccgttgccatcggacatccgataggggcaagcggcgcgaggattatcctg
acgctgatttatgagctgaagcgcaggggcggaggagtcggcatcgcggcaatctgcagc
ggcggcggccagggagatgccatcatgattgaagttccggcgaaataa

DBGET integrated database retrieval system