KEGG   Bacillus infantis: N288_25580Help
Entry
N288_25580        CDS       T02860                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bif  Bacillus infantis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bif00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    N288_25580
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    N288_25580
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    N288_25580
Enzymes [BR:bif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     N288_25580
Exosome [BR:bif04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N288_25580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4791587..4793245)
Genome map
AA seq 552 aa AA seqDB search
MKNHLRNKVAGISVAAAVAFSSLGFAVNNHLAEAKDNKKKEPANVIMMVMDGTSAGATNL
ARWYKGGNLAMDEILIGGVRTHSAESAITDSAPAATALATGNKSNDKVIGLLPALVNTPG
VSPVSEKDAHRPVANVLEGAKLAGKSTGIISTSEIQHATPAGFSSHAAHRSNYQDIAEQQ
VYQGIDVVLGGGKESLAPGTTKNARVDGENLLNVISQNGYQFVETKEALLKSKSNKIWGS
FAPSAMAYDFDRKAAKSSQPSLADMTKKAITTLDKNKEGFFLFVEGSKVDWAAHANDTVG
ILSDVLAFDDAVKEALDFAKKDGNTMVIAVSDHGNSGITMGNVNTNSNYPEIPVSAYIDP
LKKASMTLEGALSQLKADRSNMEKVAGLYGLDNLTKEELDKLKASANLQSDMAKMLANRA
NIGFSTGGHTGEDVFLYAYGPSRPFGLIDNTDIAKAMAKHMGFNLKSVTDKLFVNAKESF
EKKGYKTRIDVTDANNPVFIAEKSKTKIELPVNKNIAHIVQNNRIVTKKLDGVTVFNGKD
FYVSEKALNLSK
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcatttgaggaataaggttgccgggatttctgtggctgcggctgttgcgttt
tcttctctgggatttgctgtaaacaatcacctggctgaggcaaaggacaacaagaagaaa
gagcctgccaatgtcattatgatggtcatggacgggacaagcgcaggggccactaacctg
gcgagatggtacaaaggcgggaatctggcgatggatgagatcctcatcgggggggtgcgc
acccattccgcagaatcggcaatcacggattctgcacctgctgcaacggctttagcgaca
ggcaataaaagcaatgacaaggtaatcgggcttctgcctgcactggtgaatacaccgggt
gtctctccagtcagcgagaaggatgcccatagaccggtggccaatgtgctcgagggggca
aagctggctggaaagtcgacaggaatcatttccacatctgaaattcagcatgcaacgcct
gcaggattttcatcacatgcggcgcaccgcagcaattatcaggacattgccgagcagcag
gtataccagggcattgatgtagtccttggcggaggcaaagaatctctggcaccaggaaca
accaagaatgcccgcgttgatggcgagaatctattgaatgtgatcagccaaaacggctac
cagtttgtcgagacaaaggaagccctcctaaaatcgaaatcaaataaaatctggggctca
tttgcgccttccgcaatggcctatgactttgaccgaaaggctgctaagagcagccagcct
tctctggctgatatgacgaaaaaagcgatcacaacgctggacaagaacaaagaaggcttc
ttcctgtttgttgaaggaagcaaggtggactgggcagcgcatgccaatgacaccgtcgga
attcttagtgatgtactggcatttgatgatgcagtgaaagaagccctcgattttgcgaaa
aaagacggcaacacaatggtcatcgcagtcagtgaccacggaaacagcggaatcacaatg
gggaacgtcaacacaaacagcaattacccggaaattcctgtatcagcttatatcgacccg
ctgaaaaaagcgtccatgacacttgaaggggctttaagccaactgaaagcagaccgctca
aacatggaaaaagtggccggcctgtacggattggataatctgacaaaagaagaactcgat
aaattgaaggcgtccgcaaacctgcagtctgatatggccaaaatgctcgcaaaccgcgcg
aatatcggcttctccactggcgggcataccggcgaggatgtattcttgtacgcatatgga
ccatcaaggccttttggattgatcgataacactgatattgctaaagcaatggcaaagcat
atgggcttcaacctgaaatccgttacagacaagctgttcgtcaatgcgaaagagtcgttt
gagaaaaaaggctacaagacccgcattgatgtaacagatgcgaacaacccggtctttatc
gcagaaaaaagcaagacaaagatcgaactgcctgtgaacaaaaatatcgctcatatcgta
cagaacaacaggattgtcacgaaaaaactcgatggcgtcacggtctttaacggaaaagat
ttctatgtttccgaaaaggctttgaatctgtctaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system