KEGG   Bombus impatiens (common eastern bumble bee): 100748017Help
Entry
100748017         CDS       T04362                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Brite
Enzymes [BR:bim01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100748017
Peptidases [BR:bim01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100748017
Exosome [BR:bim04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100748017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 359 aa AA seqDB search
MQTTYLLLAALLPFAVHDIWYARIYLFWIMKVSIITYLIIFGLLPIIFHYSYTIQKKILF
LNFVQWPLNVDFSKPELVGMKGTRNFYLQTDQQVKIGLWQILPQSLLNDSIITTDDDYET
MLKNAKRPIFLYMHGNSGNRASNHRLELYKLFQSLDYHVVCFDYRGYGDSEEAELSEIGV
VSDSKYVLEWLLKIVNGTAPVFVWGHSLGTGVSVHVLALLATEKVQPAGLFLESPFNNIA
DELSEHPLSQIFKHLPWFHWVIVEPFYDNYLRFESDKHIEKIQCPIMILHAEDDNIVPFA
LGEKLFKAAINYHGNDTNRVQMTRIDATHGFGHKYICRYKNLPNIIKSFVHEVRKNQTD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaacttatctactattagctgcactgttacctttcgccgttcatgatatttgg
tatgcaagaatatacttattttggatcatgaaagtatcaataatcacataccttattata
tttgggcttctgcctattatatttcactactcatataccatacaaaagaagattcttttt
ttaaattttgtgcaatggccacttaatgtagatttttcgaaaccagaattagttggaatg
aaaggaacaagaaacttttatttacagactgatcaacaagtaaaaataggactatggcaa
atattacctcagtctttactaaatgattcaattattacaactgatgatgattatgaaact
atgttaaaaaatgctaaacgaccaattttcctttatatgcatggtaatagcggtaataga
gcaagcaatcatcgtttagaattatataaacttttccagagtttagattatcatgttgta
tgttttgattatagaggttatggtgatagtgaagaagcagaactttctgaaataggtgta
gttagtgatagtaaatatgtacttgaatggttattaaaaatagtaaatggtacagctcct
gtttttgtatggggacattcattaggaactggagtttcagttcatgtattggcattatta
gcaacagaaaaagttcagcctgcaggtttattcttggaatcaccatttaataatatagca
gatgaattaagtgaacatcctttatcacagatatttaaacatttaccatggttccattgg
gtaattgttgaaccgttttatgataattatctccgttttgaatctgataaacacatagaa
aaaatccaatgtcctattatgatattgcatgcagaagatgataatattgttccatttgct
ttaggtgaaaagttatttaaagcggcaataaattatcatggaaacgacacaaatcgcgtt
cagatgacaaggattgatgcaacacatggttttggacataaatatatatgtcgttataaa
aacttacctaatataattaaatcatttgtacacgaggtacgtaaaaaccagactgattaa

DBGET integrated database retrieval system