KEGG   Brachyspira intermedia: Bint_0055Help
Entry
Bint_0055         CDS       T01847                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bip  Brachyspira intermedia
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bip03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(55465..56169)
Genome map
AA seq 234 aa AA seqDB search
MLKYKVNIILLGRLEVMKELPNLITLINSIKGEICYSYINKIVAIDKQYKEMEDIEGQKI
IDVLRYGGYMHFQFSQDAMLVDLGPNGSFVLTEDDDYENSILKLETDHGNFFVVDDSKDK
NEITKIIPIWKDSTTMPQIGYDPLTKQFNYNLFCQLLADNDTTVEKLIKNPLILSGIGNV
YGDMILKKASITKKTKTSDVTKVKAREIFDAIKQVLREASGNTEEDDGDSSEEE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaatataaagtaaacataatactattaggaagattagaagttatgaaagaactg
ccaaatttaattacattaataaactcaataaaaggtgaaatttgctattcttatataaat
aaaatagtagccatagataaacaatacaaagaaatggaagatatagaaggtcagaaaata
atagatgttctaagatacggcggatacatgcattttcagttttctcaagacgctatgctt
gtagacttaggccctaatggatcattcgtattaacagaagatgatgattatgaaaacagc
atattaaaattggaaaccgatcatggcaatttctttgttgtagatgatagtaaagataaa
aatgaaataactaaaataatacctatttggaaagattctacaacaatgcctcaaatagga
tatgaccctcttactaaacaattcaattataatttattctgtcaattattagcagataat
gatactacagtagaaaagctcataaaaaaccctttaatattgagcggaataggtaatgta
tatggcgatatgatattaaagaaagcatctatcactaaaaaaactaaaacatcagatgta
actaaagtaaaagcaagagaaatatttgatgccataaaacaagtattgagagaggcctcc
ggaaacacagaagaagatgacggagattcatcagaagaagaataa

DBGET integrated database retrieval system