KEGG   Brachyspira intermedia: Bint_1052Help
Entry
Bint_1052         CDS       T01847                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bip  Brachyspira intermedia
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bip00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bip00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1185870..1187198
Genome map
AA seq 442 aa AA seqDB search
MESKEMEYFTSTDKVLYKGKDSKDAFSFKQYNASEVIAGKTMEEWMPFAMSWWHTLAAGS
ADPFGAPAASRPWNGKEALEASKMRVEAGFELMQKLGMNYFCFHDRDLAPEYKTLKETNE
KLDMIVDLIQESMSKTGKKLLWATSSLFTNPRYMHGAATSPYADVFAVAAAQTKKTMDIA
KKLNAKGYVFWGGREGYETLLNTDMKRELDHLAYFLSMAVEYKEKIGFKGQFFIEPKPKE
PTKHQYDFDAATTLEFLYHYNLDKYFELNLEVNHATLAGHTMQHEMQVARNHGKLGSVDI
NYGDTFLGWDTDMFLTNVYDAVLMMVEIIRNGGLKNGGFNFDAKVRRPSHTMDDLMYAYI
AGMDTLAWGLRIADKIVKDGCFDKFIEERYSSYNSGIGAKIESKSTSLEELYDYALALEE
KELPSGNQELLEAKLNQFIYNL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttggagagtaaagaaatggaatattttacaagtacagataaagtgctttataaaggaaaa
gacagtaaagatgctttttcattcaaacaatataatgcttcagaagttatagcaggtaaa
actatggaagaatggatgccttttgcaatgagttggtggcatacattagctgctggaagt
gcagatccttttggagctcctgcagcaagcagaccttggaatggtaaagaggcattagaa
gcttctaaaatgagagtggaggctggatttgaacttatgcagaaactaggaatgaattat
ttctgttttcatgacagagatttagctcctgaatataaaactctaaaagaaactaatgaa
aaattagatatgatagtagatttgatacaagaaagtatgtctaaaacaggtaagaaactt
ttatgggctacttcatctttatttacaaatcctagatatatgcatggtgctgctactagc
ccttatgctgatgtttttgcagttgctgctgctcagactaaaaaaactatggatatagct
aaaaaattaaatgctaaaggatatgtattctggggtggtagagaaggatatgaaacttta
cttaatactgatatgaaaagagaattagatcatttggcttatttcttatctatggcagtt
gaatataaagaaaaaataggatttaaaggacaattctttattgagccaaaaccaaaagaa
ccaacaaaacatcaatatgattttgatgctgctactactttagagttcttatatcattat
aatttagacaaatattttgagcttaatttggaagtaaaccatgctactttggcaggacat
actatgcagcatgagatgcaggttgctagaaatcatggaaagttaggttctgttgatatt
aactatggtgatactttcttgggttgggatacagatatgttccttactaatgtatatgat
gcagtattaatgatggtagagattataagaaatggcggattaaaaaatggcggattcaac
ttcgatgctaaagtaagaagaccatctcatactatggacgatttgatgtatgcatatatt
gctggaatggatactttagcttggggattaagaatagctgataaaatagttaaagacgga
tgtttcgataaatttattgaagagagatatagttcttataatagtggaataggtgcaaaa
atagaaagtaaatcaacttcattagaagagttatatgattatgcacttgcattagaagaa
aaagaacttcctagcggtaatcaggaattacttgaagctaaattaaatcaatttatatat
aatttataa

DBGET integrated database retrieval system