KEGG   Brachyspira intermedia: Bint_1671Help
Entry
Bint_1671         CDS       T01847                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bip  Brachyspira intermedia
Pathway
bip00260  Glycine, serine and threonine metabolism
bip00750  Vitamin B6 metabolism
bip01100  Metabolic pathways
bip01110  Biosynthesis of secondary metabolites
bip01120  Microbial metabolism in diverse environments
bip01230  Biosynthesis of amino acids
Module
bip_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bip00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bint_1671 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bint_1671 (thrC)
Enzymes [BR:bip01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bint_1671 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: AEM22290
UniProt: G0EIT8
Position
complement(1891916..1892971)
Genome map
AA seq 351 aa AA seqDB search
MKAWKGLLREYRKYLPITHQTPLITLHEGNTPLIKAERIGRDLDIELYLKYDGLNPTGSF
KDRGMVMAVAKALEGRDTKAIMCASTGNTSASAAAYAARSGIDCIVVIPDGNIALGKLAQ
ALMYGAKVIAIKGNFDEALKAVVDITNKYPITLVNSINPFRLQGQKTSAFEICDVLGKAP
DYLAIPVGNAGNISAYWMGFKEYKENGNINNLPKMIGFEAEGSAAIVQNKIIENPQTLAT
AIKIGNPASWKLAVNAANESEGFIDSVTDDEILEAYKMLTMEEGVFAEPASAASLAGIIK
SRKAGKINKGDTVVSVLTGNGLKDPDNAIKICNEPIKVDNNIEEIRKAIGI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttggaaaggacttttaagagaatacagaaaatatttacctattacgcatcaa
accccattaataaccttgcatgaaggaaacacccctttaattaaagctgaaagaatagga
agggatttagacatagaattatatttgaaatatgacggacttaatcctacaggttctttt
aaagatagaggtatggttatggctgttgctaaagcacttgaaggtagagatactaaagct
ataatgtgtgcttctacaggaaatacttctgcatctgctgctgcttatgctgctagaagc
ggtatagattgtatagtggttatacctgacggaaatattgctttgggtaaattagctcag
gctttaatgtacggtgctaaagttatagctattaaaggaaattttgatgaggctctaaag
gctgtggttgatattaccaataaatatcctattactttggtaaattctatcaatcctttc
agacttcagggacaaaaaacttccgcatttgaaatttgtgatgttttaggaaaagctcct
gattatttagctatacctgttggaaatgctggtaatatatctgcatattggatgggcttc
aaagaatataaagaaaatggaaatataaataatcttccaaaaatgataggtttcgaggct
gaaggttctgctgctatagtacaaaataaaataatagagaatcctcaaacattagctact
gctataaaaataggaaatcctgccagctggaaacttgctgttaatgctgctaatgaatca
gaaggttttattgactctgttactgatgatgagatattagaggcttataaaatgcttaca
atggaagaaggtgtatttgctgagcctgcttctgctgcttctcttgctggtataataaaa
agccgtaaagctggaaagataaataaaggtgatactgtagtgtctgtattaacaggaaac
ggacttaaagaccctgataatgcaattaaaatctgcaatgaacctataaaagttgacaac
aatatagaagaaataagaaaagctataggaatatga

DBGET integrated database retrieval system