KEGG   Brachyspira intermedia: Bint_1671Help
Entry
Bint_1671         CDS       T01847                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bip  Brachyspira intermedia
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bip00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bint_1671 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bint_1671 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bint_1671 (thrC)
Enzymes [BR:bip01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bint_1671 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1891916..1892971)
Genome map
AA seq 351 aa AA seqDB search
MKAWKGLLREYRKYLPITHQTPLITLHEGNTPLIKAERIGRDLDIELYLKYDGLNPTGSF
KDRGMVMAVAKALEGRDTKAIMCASTGNTSASAAAYAARSGIDCIVVIPDGNIALGKLAQ
ALMYGAKVIAIKGNFDEALKAVVDITNKYPITLVNSINPFRLQGQKTSAFEICDVLGKAP
DYLAIPVGNAGNISAYWMGFKEYKENGNINNLPKMIGFEAEGSAAIVQNKIIENPQTLAT
AIKIGNPASWKLAVNAANESEGFIDSVTDDEILEAYKMLTMEEGVFAEPASAASLAGIIK
SRKAGKINKGDTVVSVLTGNGLKDPDNAIKICNEPIKVDNNIEEIRKAIGI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttggaaaggacttttaagagaatacagaaaatatttacctattacgcatcaa
accccattaataaccttgcatgaaggaaacacccctttaattaaagctgaaagaatagga
agggatttagacatagaattatatttgaaatatgacggacttaatcctacaggttctttt
aaagatagaggtatggttatggctgttgctaaagcacttgaaggtagagatactaaagct
ataatgtgtgcttctacaggaaatacttctgcatctgctgctgcttatgctgctagaagc
ggtatagattgtatagtggttatacctgacggaaatattgctttgggtaaattagctcag
gctttaatgtacggtgctaaagttatagctattaaaggaaattttgatgaggctctaaag
gctgtggttgatattaccaataaatatcctattactttggtaaattctatcaatcctttc
agacttcagggacaaaaaacttccgcatttgaaatttgtgatgttttaggaaaagctcct
gattatttagctatacctgttggaaatgctggtaatatatctgcatattggatgggcttc
aaagaatataaagaaaatggaaatataaataatcttccaaaaatgataggtttcgaggct
gaaggttctgctgctatagtacaaaataaaataatagagaatcctcaaacattagctact
gctataaaaataggaaatcctgccagctggaaacttgctgttaatgctgctaatgaatca
gaaggttttattgactctgttactgatgatgagatattagaggcttataaaatgcttaca
atggaagaaggtgtatttgctgagcctgcttctgctgcttctcttgctggtataataaaa
agccgtaaagctggaaagataaataaaggtgatactgtagtgtctgtattaacaggaaac
ggacttaaagaccctgataatgcaattaaaatctgcaatgaacctataaaagttgacaac
aatatagaagaaataagaaaagctataggaatatga

DBGET integrated database retrieval system