KEGG   Brachyspira intermedia: Bint_1824Help
Entry
Bint_1824         CDS       T01847                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
bip  Brachyspira intermedia
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bip00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2086451..2088232
Genome map
AA seq 593 aa AA seqDB search
MFRMQNNLPKVGIRPVIDGRRNGVRESLEDTTMNMAKIAAKLIEENIKHPSGEKVECVIS
DTTIGGVAEAARCQKKFDENNVKLTLTVTPCWCYGSETIDMTPAIPKAIWGFNGTERPGA
VYLAAADAGHTQLGLPVFSIYGKDVQDAGDENVPDDVKEKILRFVRAGLAVATMKDQSYI
SMGYVAMGIMGSMVDAEFLLDYLGMRTEFVDMSEIKRRLELEIYDKEEFKKAWEWAKQCK
FGADNNKVKASDEEKEKEWATSIKMAMIMRDLMVGNPKLAEMGYIEEAQGHNAIVGGFQG
QRHWTDYMPNGDFAEAILNSSFDWNGIREPYVVATENDSLNGLSMLFAHLLTCKSQLFAD
VRTYWSPEAVKRVTGKELTGKAKDGIIHLINSGAASLDWTGEEKVNGNPALKEFWNITEE
EAKKCLDATQFSPANREYFRGGGFSSTFLTKGEMPMTIIRLNLVKGYGPVLQVAEGYAVN
IDDSIFDPINKRTDSTWPTTWFAPILTGKDSFKDVYSVMNDWGANHCAAAYGHIGADLIT
LASMLRIPVSMHNVSEDRIFRPKAWKAFGTKDLEGADFRACKHFGPLFGKVTR
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaatgcaaaataatttaccaaaagtaggtattagacctgttatagatggtaga
agaaatggtgttagagaatctctcgaagacactactatgaatatggctaaaatagctgca
aaacttatagaagaaaatattaaacatcctagcggtgaaaaagttgaatgcgtaatatct
gatactacaatcggtggagttgctgaagctgctagatgtcagaaaaaatttgatgaaaac
aatgttaaattaactcttactgttacaccttgttggtgttatggttctgaaactattgat
atgactcctgctatacctaaagcaatttggggtttcaatggtactgaaagacctggtgct
gtttacttggctgctgctgatgctggacatactcaattaggacttcctgtattctctatc
tatggtaaagatgttcaagatgcaggcgatgaaaatgttcctgatgatgttaaagaaaaa
atacttagattcgtaagagctggtcttgctgttgctactatgaaagatcaatcatacata
agtatgggttatgttgctatgggtattatgggttctatggttgatgctgaattcttactt
gactatttaggaatgagaactgaattcgtagatatgagtgaaatcaaaagaagattagaa
ttagaaatctatgataaagaagaattcaaaaaagcttgggaatgggctaaacaatgcaaa
tttggtgctgataacaataaagtaaaagcttctgatgaagagaaagaaaaagaatgggct
acttctattaaaatggctatgattatgcgtgatttaatggtaggcaatcctaaattagct
gaaatgggatatatagaagaagcacaaggtcataatgctatagttggcggtttccaaggt
caaagacattggactgactatatgcctaacggcgactttgctgaagctattcttaactca
tctttcgactggaacggtataagagaaccttatgttgttgctactgaaaatgactctttg
aatggtctttctatgttattcgctcatttactaacttgtaaatctcaattatttgctgat
gttagaacttattggagtcctgaagcagttaaaagagttacaggaaaagaacttactgga
aaagctaaagacggtattattcacttaatcaattcaggtgctgcatctttagactggact
ggtgaagaaaaagttaatggaaatcctgctttaaaagaattctggaatatcactgaagaa
gaagctaaaaaatgtcttgatgcaactcaattctctcctgctaacagagaatatttcaga
ggaggcggattctcatctactttcttaactaaaggtgaaatgccaatgactataatcaga
cttaacttagttaaaggttatggtcctgtacttcaagtagctgaaggttatgctgttaat
attgatgatagtatatttgatcctattaacaaaagaactgactctacttggcctactact
tggtttgctcctatacttacaggtaaagactctttcaaagacgtttattctgtaatgaat
gattggggtgctaaccactgtgctgctgcttatggacatataggtgctgatttaattaca
ttagcttctatgttacgtatacctgtaagcatgcataatgttagtgaagatagaatattt
agacctaaagcttggaaagcatttggtacaaaagatttagaaggtgctgatttcagagct
tgtaaacattttggacctttatttggaaaagtaactaggtaa

DBGET integrated database retrieval system