KEGG   Brachyspira intermedia: Bint_1844Help
Entry
Bint_1844         CDS       T01847                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bip  Brachyspira intermedia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bip00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bint_1844 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bint_1844 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bint_1844 (trpB)
Enzymes [BR:bip01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bint_1844 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2113399..2114652
Genome map
AA seq 417 aa AA seqDB search
MKNSDKGFFGKFGGRFVPEALEKLLIELEEAFLHYINDKEFLSELEELRSDFLGRPTPLM
YAKNLSEKIGGAKIYVKLEGLAHTGAHKINNSIGQALLAKKMGKKKIIAETGAGQHGLAT
AAACAKLGLECSIYMGEIDVKRQQPNVASMELYGANVVSVTKGGRGLKDAVDAALEDWVK
DLKDTHYLLGSAVGPSPYPDIVRTFQSVIGRELDKQIQERNLNVKALIACVGGGSNAIGF
FEPFIERENPKLIAVEAGGISMNLGENAIRMTNPYAKDIAAQGYMSKFILKEDGEISETM
SISAGLDYPGVGPQLAYLGESGRIEFTYATDKEAINAVKEFAKNEGVIFALESAHAGAKA
IEYAKQYTKDDVIIVNMSGRGDKDIFITSPIFRPDKWKEFLKSELERLEKNIDIHKF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacagtgataaaggttttttcggtaaattcggaggaagatttgtaccggaagca
ttagaaaaattattaattgaattggaagaggctttcctgcattatattaatgataaagaa
tttttaagcgagcttgaagaattgagatctgattttctaggcagacctacaccattaatg
tacgccaaaaacttgtcagagaaaattggcggagcaaagatatatgtcaaactagaaggg
cttgctcatacaggggcacataaaattaataattctataggacaggcattacttgccaaa
aagatgggtaagaagaagattatagcagaaaccggagccggacagcatggacttgccacc
gctgcagcctgtgccaaattaggacttgaatgctctatttatatgggtgaaatagatgta
aaaagacagcagcctaatgtagcttctatggagttatacggtgctaatgtagtatccgtt
actaaaggaggacgcggacttaaagatgctgttgatgcggcattagaagattgggttaaa
gatttaaaagatactcattatttacttggaagtgctgttggccctagcccttatcctgat
attgtaagaacttttcaatctgtaataggaagagaattggataaacagatacaggaaagg
aatttaaatgttaaagcattgatagcatgtgttggaggcggttctaatgctataggattt
tttgagccttttatagagagagaaaatccaaaactaatagctgtagaagctggcggaata
agtatgaatcttggagaaaatgctattagaatgacaaatccttatgccaaagatattgct
gctcagggatatatgagtaaatttatcttaaaagaagacggagaaatatctgaaaccatg
tctatatctgcaggacttgattatccaggagttggtcctcagcttgcatatttaggagaa
tccggaagaatagaatttacttatgctacagataaagaagcaataaatgcagtaaaagaa
ttcgcaaaaaatgaaggtgttatatttgcattagaaagtgcccatgccggtgctaaagct
atagaatatgcgaagcagtacactaaagatgatgttattatagttaatatgtcaggcaga
ggagataaagatatattcataacctcacctattttcagacctgataaatggaaagaattc
ttaaaaagtgaattagaaagattagaaaaaaatatagatattcacaaattttaa

DBGET integrated database retrieval system