KEGG   Brachyspira intermedia: Bint_1966Help
Entry
Bint_1966         CDS       T01847                                 

Gene name
bglX
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bip  Brachyspira intermedia
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bip00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bip00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2261160..2262194)
Genome map
AA seq 344 aa AA seqDB search
MFLILLLFYACKSASSVMEEQSYIDELKQSYPDLSSYIDKVAEMSDKERKGLLLMVGIKD
KVLSEETIKTLKDNHIMGVILFDYNITDEKQLKKLTSDLRKYVNPNMLISIDQEGGEVNR
INFDKLKNISPKNIGDSNSAEYAYNIAYQKSKFLLDLGINMILGPLCDIPNDTNSYLYNR
SFSTNVNIVAEMVSNTVKAQRDAGIISVLKHFPGHGDTAVNSHNDFPSINKTTNELLSNE
FIPFKSGIDAGAEMVLVAHIKNKYIDNKNTASMSKKYADILEKDLGFNGVIITDDLAMTG
NIDKGINFGINLISNVYENVEYMFEDIDADIISCARLLKIISEK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttaatattattattattttatgcatgtaaaagtgcttctagtgttatggaagaa
caaagttatatagatgagttaaaacaatcttatcctgatttatcatcttatatagataaa
gtagcagaaatgagtgataaagagagaaaaggtttacttttgatggtaggtataaaggat
aaggtgctttcagaagagactattaaaactcttaaagataatcatataatgggtgtaata
ctatttgattataatattacagatgaaaaacagctaaaaaagttaacatcagatttaagg
aaatatgttaacccaaatatgttaatttctatagatcaggaaggaggggaggtcaatcgc
attaattttgataagttaaaaaatatatctccaaagaatataggagattcaaatagtgca
gaatatgcttataatatagcttatcaaaaatctaagttcttattggatttaggaattaat
atgatattaggacctttatgcgatattcctaatgatacaaattcttatctatataataga
agtttttcaacgaatgttaatatagttgctgaaatggtttcaaatacagttaaggctcaa
agagatgcaggaattataagtgtattaaaacattttccgggacatggagatactgctgta
aactctcataacgattttccaagcattaataaaactacaaatgaattattatcaaatgag
tttattccttttaaaagcggtatagatgcaggggcagaaatggttttggttgctcatata
aaaaataaatatatagacaataaaaatactgctagtatgtcaaaaaaatatgctgatata
ttagaaaaagatttaggctttaatggggtaattattacagatgatttggctatgacagga
aacattgataaaggaattaattttggtattaatttgataagtaatgtatatgaaaatgta
gagtatatgtttgaagatatagatgctgatatcatttcatgtgcgagattattaaaaata
atttcagaaaaataa

DBGET integrated database retrieval system