KEGG   Brachyspira intermedia: Bint_2025Help
Entry
Bint_2025         CDS       T01847                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bip  Brachyspira intermedia
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bip00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bip00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2330171..2330527)
Genome map
AA seq 118 aa AA seqDB search
MQDLYKKYKKDGFEILDFPCNQFGGQAKEPIEEIAEFRKEKYGITFKLFDKVKVNSKNAD
PLFTYLRTEKPTEEGVDKIRWNFGKFLIDRQGNIVGRYDPRVKPEELDEIVAELLKKE
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggatttatacaaaaaatataaaaaggatggttttgaaatattagactttccttgt
aatcaattcggcggacaggctaaagaacctattgaagaaattgctgagtttagaaaggag
aaatacggcattactttcaagctatttgacaaagttaaagttaatagtaaaaatgctgat
cctttatttacttatttaagaacagaaaagcctactgaagaaggcgttgataaaataaga
tggaatttcggtaagtttttaatagataggcaaggaaatatagttggacgctatgatcct
agagtaaagcctgaagaacttgatgagatagtagccgaattattaaaaaaagaataa

DBGET integrated database retrieval system