KEGG   Brachyspira intermedia: Bint_2346Help
Entry
Bint_2346         CDS       T01847                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bip  Brachyspira intermedia
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bip01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bip00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2675803..2677077
Genome map
AA seq 424 aa AA seqDB search
MIKVINYKECKSLDDILLRSQFSHDDVNEKVKAILEDVKQNGDNALKKYSKMFDNAEIET
LEVTEKEIEEAYNRVDDKFKETLNLAYNNIEKFHKKQLRNSYITNEEDGIVMGQIINPIE
KVGVYIPGGTAVYPSTVLMNVIPAKVAGVNEIILVSPPNKEGKINDNILAAAKISGVNKI
FKTGGAQAIAALSYGTESIPKVYKIVGPGNIYVAMAKRLVYGEVSIDMVAGPSEVLIIAD
ETANHIHIASDMLAQAEHDKLASSILVTTSKDIAEKTKEELYKQLEKLSRKDIALESIEN
NGRIIITETIDEAIYISNEIAPEHLEISIKEPFSVLSKIKNAGSIFLGDYTPEALGDYLS
GANHVIPTSGTAKFASPLSVDDFIKKSYITYYTKDALSKVKENIINFAEHESLEAHANSV
KVRF
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagtaattaattataaagaatgcaaatcattagatgacatattattaagaagc
caattcagtcatgatgatgttaatgagaaagtgaaggccatattagaagatgtaaaacaa
aatggagataatgcattaaaaaaatattctaagatgtttgataatgcagaaatagaaact
ttagaagtaacagaaaaagaaatagaagaagcatataacagagttgatgataagtttaaa
gaaacattaaatctagcttataacaatatagaaaaattccataaaaaacaattaagaaat
agttatataacaaatgaagaagacggaatagtaatgggacagattataaacccaatagaa
aaggtcggagtttatattccaggaggcacagcagtttatccttctacagtacttatgaat
gtaatacctgcaaaagtagccggagtcaatgaaataatattggtatctcctccaaacaaa
gaaggaaaaataaatgataatatattagccgctgcaaaaatatcaggagtaaacaaaata
ttcaaaacaggcggtgctcaggcaatagcagctttaagttacggtacagagtccattcca
aaggtatataaaatagttggccctggaaatatatatgttgctatggctaaaagacttgta
tacggtgaggtttctattgatatggtggctggtccaagtgaagtattaataatagccgat
gaaacagcaaatcatatacatatagcctctgatatgcttgcacaggctgaacatgataaa
ttagcttcaagtatattagtaactacaagcaaagacatagctgaaaaaacaaaagaagaa
ttatacaaacaattagaaaaattaagccgtaaagatatagctttagaatctatagaaaat
aacggcagaataataataactgaaactatagatgaagcaatatatataagcaatgaaata
gcaccggagcatttagagataagcataaaagagcctttctctgtattaagcaaaataaaa
aatgcaggatcaatatttttaggagattatactcctgaggctttaggagattatttatca
ggtgctaatcatgtaatacctacaagcggaacagctaaatttgcttctccattatcagta
gatgattttataaagaaatcttatataacttattatactaaagatgctttgagtaaagta
aaagaaaatataatcaattttgcagagcatgaaagtttagaagcacatgctaattctgta
aaagtaagattttaa

DBGET integrated database retrieval system