KEGG   Brachyspira intermedia: Bint_2746Help
Entry
Bint_2746         CDS       T01847                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bip  Brachyspira intermedia
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bip01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bip00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3105489..3106373
Genome map
AA seq 294 aa AA seqDB search
MSKTIRLIYPQWQGGIISDWIKELNPEDSSRGYYLGAKLLSILAPQNDNHETLEVPVSLD
IKNREIKNGIMDYDFIVSQTKNALDILSKNNPDKIITFGGECSVSVVPFTYLNKKYDNDA
ALIWIDAHPDITLPEDNTYAGYHAMAVSACMGNVDKNISYILPSKISADRILFVGLRDWE
RDEIKKRQEEYGITHFAPEAISSSSESVIEWLKKSNASKVLIHFDLDVLDPNEIIAAVGV
SPNGMKINEAVRIINDIAKEKEIVGFTIAEHMPRIEIMLKNMMADLSLFNELNN
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaactataagattgatttatccgcagtggcagggcggaattatatctgattgg
ataaaggaattaaatcctgaagattcttcaagaggttattatcttggggcaaaacttctt
agcatacttgcacctcaaaatgataatcatgaaactttagaagttcctgtttctttggat
ataaaaaacagagaaataaaaaatggtattatggattatgattttatagtatctcaaact
aaaaatgccttagatattttaagcaaaaataatcccgataaaataatcacttttggaggc
gaatgttctgttagtgtagtgcctttcacatatttaaataaaaaatatgataatgatgct
gctttaatttggatagatgctcatcctgatattactttgcctgaagataatacttatgca
ggatatcatgctatggctgttagtgcttgtatgggtaatgttgataaaaatataagctat
atacttccaagcaaaatttcagctgatagaatattatttgtagggcttagagattgggaa
agagatgagataaaaaaacgtcaagaggaatacggcataactcattttgctcctgaagct
atttcttcatcaagtgaatctgtaatagaatggctaaaaaaatctaatgcttctaaggtt
ttgatacattttgatttagatgtgcttgatcctaatgagataatagctgctgtcggtgtt
tctccgaacggaatgaagataaatgaagcagtgagaataataaatgatattgccaaagaa
aaggaaattgttggctttactatagcggaacatatgccaagaattgagataatgcttaaa
aatatgatggcagatttgagtttatttaatgagctcaataactaa

DBGET integrated database retrieval system