KEGG   Brachyspira intermedia: Bint_2746Help
Entry
Bint_2746         CDS       T01847                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bip  Brachyspira intermedia
Pathway
bip00220  Arginine biosynthesis
bip00330  Arginine and proline metabolism
bip01100  Metabolic pathways
bip01110  Biosynthesis of secondary metabolites
bip01130  Biosynthesis of antibiotics
bip01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bip00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Bint_2746 (rocF)
   00330 Arginine and proline metabolism
    Bint_2746 (rocF)
Enzymes [BR:bip01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Bint_2746 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase Peptidase_M17_N
Motif
Other DBs
NCBI-ProteinID: AEM23340
UniProt: G0EQ82
Position
3105489..3106373
Genome map
AA seq 294 aa AA seqDB search
MSKTIRLIYPQWQGGIISDWIKELNPEDSSRGYYLGAKLLSILAPQNDNHETLEVPVSLD
IKNREIKNGIMDYDFIVSQTKNALDILSKNNPDKIITFGGECSVSVVPFTYLNKKYDNDA
ALIWIDAHPDITLPEDNTYAGYHAMAVSACMGNVDKNISYILPSKISADRILFVGLRDWE
RDEIKKRQEEYGITHFAPEAISSSSESVIEWLKKSNASKVLIHFDLDVLDPNEIIAAVGV
SPNGMKINEAVRIINDIAKEKEIVGFTIAEHMPRIEIMLKNMMADLSLFNELNN
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaactataagattgatttatccgcagtggcagggcggaattatatctgattgg
ataaaggaattaaatcctgaagattcttcaagaggttattatcttggggcaaaacttctt
agcatacttgcacctcaaaatgataatcatgaaactttagaagttcctgtttctttggat
ataaaaaacagagaaataaaaaatggtattatggattatgattttatagtatctcaaact
aaaaatgccttagatattttaagcaaaaataatcccgataaaataatcacttttggaggc
gaatgttctgttagtgtagtgcctttcacatatttaaataaaaaatatgataatgatgct
gctttaatttggatagatgctcatcctgatattactttgcctgaagataatacttatgca
ggatatcatgctatggctgttagtgcttgtatgggtaatgttgataaaaatataagctat
atacttccaagcaaaatttcagctgatagaatattatttgtagggcttagagattgggaa
agagatgagataaaaaaacgtcaagaggaatacggcataactcattttgctcctgaagct
atttcttcatcaagtgaatctgtaatagaatggctaaaaaaatctaatgcttctaaggtt
ttgatacattttgatttagatgtgcttgatcctaatgagataatagctgctgtcggtgtt
tctccgaacggaatgaagataaatgaagcagtgagaataataaatgatattgccaaagaa
aaggaaattgttggctttactatagcggaacatatgccaagaattgagataatgcttaaa
aatatgatggcagatttgagtttatttaatgagctcaataactaa

DBGET integrated database retrieval system